KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_3208Help
Entry
GDI_3208          CDS       T00631                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    GDI_3208 (pncA)
Enzymes [BR:gdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     GDI_3208 (pncA)
    3.5.1.-  
     GDI_3208 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3299360..3299872
Genome map
AA seq 170 aa AA seqDB search
MPEGDAVIPVINHLTRLPFGQQAASQDWHPHGHASFATAQPPGPWRQHCVAGTPGAELAA
SLDQTRIGLVIRKGRAQDVDSYSAFLDNDRTTRTGLEDWLRGLGITRIFIAGLALDYCVA
FTAIDAKALGFETIVVEDACRGIDPDPDATWQALARHDILHVRSAELAGQ
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagggggacgccgtcattcccgtcatcaaccacctgacgcgcctgcccttcggc
cagcaggcggccagccaggactggcacccgcacggtcatgcatccttcgccaccgcccag
ccgcccggcccctggcgacagcattgcgtcgccggcactccgggcgcggagctggcggcg
tcgctggaccagacgcggatcggcctggtgatccgcaagggccgcgcgcaggacgtcgac
agctattccgccttcctcgacaacgaccggaccacccgtacggggctggaggactggctg
agggggctggggatcacgcgaatcttcatcgccggcctggcgctggattattgcgtggcc
ttcaccgccatcgacgcgaaagcccttggttttgaaacgatcgtggtcgaagatgcctgc
cgtgggatcgatcccgaccccgacgccacatggcaggccctggcgcggcacgatatcctg
catgtccggtccgccgaactggcgggacagtaa

DBGET integrated database retrieval system