KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_3321Help
Entry
GDI_3321          CDS       T00631                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:gdi00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3412101..3412898
Genome map
AA seq 265 aa AA seqDB search
MTHSSSLLQAGDQALLDLATRLADEAAALIRAIRARGFETVTKSDSSPVTEADHAAEAHI
LAGLRAAFPHIPVIAEEEAAAGIRVAGGKTFWLVDPLDGTREFAAGRDDFTVNIGLVRNG
RAVLGAVALPAYHQLYAAHVATGAMRIDADGTHAIHARPAPGEGLTVLASRHYADDPRLA
SFLGGHRIAHLGNIGSAAKFIRVAEGAADLYPRLGTTMEWDTAAPQAVVEAAGGSVALLD
GTPLRYGKPDWRNPHFICAGKREHS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacgcattcatcctctctcctgcaggctggcgaccaggcgctgctggacctggcgacc
cgactggccgacgaggccgccgccctgatccgcgccatccgcgcgcgcgggttcgaaacc
gtcacgaagtcggattcgtccccggtgaccgaagccgaccacgccgccgaggctcacatc
ctggccgggctgcgcgccgcgttcccgcacatcccggtcattgccgaggaagaggccgcc
gccggtatccgcgtcgcgggcggcaagacgttctggctggtcgatccgctggacggcacg
agggaattcgccgcgggccgcgacgatttcaccgtcaatatcgggctggtccgcaacggc
cgcgccgtgctgggcgcggtcgcccttccggcctatcaccagctctatgccgcccatgtc
gccaccggcgccatgcgcatcgacgcggacggcacccacgcgatccatgcccgcccggca
cccggggaagggctgacggtgctggcgtcgcgccattacgccgacgatccgcgcctggca
tcgttcctgggggggcaccggatcgcgcatctgggcaatatcgggtccgccgcgaagttc
atccgcgtggcggaaggcgcggccgatctctacccccggctgggcacgaccatggaatgg
gacaccgccgccccgcaggccgtggtcgaggccgcgggcggcagcgtcgccctgctggac
ggcacgcccctgcgctacgggaagcccgactggcgcaacccgcattttatatgtgcggga
aagcgggagcattcatga

DBGET integrated database retrieval system