KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_3466Help
Entry
GDI_3466          CDS       T00631                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gdi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3564122..3564715)
Genome map
AA seq 197 aa AA seqDB search
MGGTDIERLIALLARLPGLGPRSARRAALALLRQPQARMLPLAQAMEQAARSVRTCSSCG
NLDTHDPCTICADPGRDRGLVCVVETVGDLWALERAGVHRGVYQVLGGTLSALAGMGPDD
LNVASLLARIEQGGVREIILALGATVDGATTAHWLQDRLAAFDVPVSRVGQGVPMGGALD
VLDDGTLAAALMARRPA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcacggacatcgaacggctgatcgcgctgctggcgcgcctgccgggcctgggt
ccgcgttcggcccgccgtgcggcgctggcgctgctgcgccagccccaggcgcggatgctg
ccgctggcccaggcgatggagcaggcggcgcggtcggtgcgcacctgttcgtcctgcggc
aacctagatacgcatgatccctgcaccatctgcgccgatcccggccgcgatcgcggcctg
gtctgcgtggtcgagacggtgggggatctgtgggcgctggaacgcgccggcgtgcatcgc
ggcgtctatcaggtgctgggcggcacgctctcggccctggcgggcatggggccggatgat
ctgaacgtggcgtcgctgctggcgcggatcgaacagggcggggtgcgcgaaatcatcctg
gcgctgggcgccacggtcgatggcgccaccacggcgcactggctgcaggaccggctggcc
gccttcgacgtgccggtcagccgggtcgggcagggggtgccgatgggcggcgcgctggac
gtgctggacgacggcacgctggccgcagccctcatggcgagacgacctgcttaa

DBGET integrated database retrieval system