KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_0100Help
Entry
Gdia_0100         CDS       T00798                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Gdia_0100
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Gdia_0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(113229..113756)
Genome map
AA seq 175 aa AA seqDB search
MDSKDVNRIGAAILVAALALGASAWAGYVAIPSGTPGHPAFVLPQPAVAADASGPAAAPP
SIADAVAHADPKAGQALAARMCAMCHSFAKDGPAMIGPDLYGVPGTAIGDMPGYEFSAAL
AAHKAERWTDDALSSWLEGPGRFAPGTRMAFPGVADAADRAAIIAFLHTLSDGAH
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaaggacgtcaaccgtatcggagccgccatcctggtggccgccctggcgctg
ggggcaagtgcctgggccggctatgtggccattccgtccggcacgcccggacaccccgcc
ttcgtcctgccccagccggcggtggcggccgatgcctccggtccggcggctgccccgccc
tcgatcgccgatgccgtcgcccacgccgaccccaaggccgggcaggccctggcggcacgc
atgtgcgcgatgtgccacagcttcgccaaggacggaccggcgatgatcggcccggacctg
tacggcgtgccggggaccgcgatcggcgacatgccgggctatgaattttcggcggcgctg
gcggcgcacaaggccgagcgctggaccgacgacgccctgtcgtcctggctggaagggccg
ggccgcttcgcccccggcacccgcatggccttccccggcgtggcggatgccgccgaccgg
gccgcgatcatcgccttcctgcacacgctttcggacggagcccactga

DBGET integrated database retrieval system