KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_0121Help
Entry
Gdia_0121         CDS       T00798                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Gdia_0121
   00052 Galactose metabolism
    Gdia_0121
   00500 Starch and sucrose metabolism
    Gdia_0121
   00520 Amino sugar and nucleotide sugar metabolism
    Gdia_0121
Enzymes [BR:gdj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Gdia_0121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
136436..137308
Genome map
AA seq 290 aa AA seqDB search
MIKPLRKAVLPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAIDEARAAGIEEFCLITGR
GKDSLIDYFDVAFELETTLRERNKLDALEALGPTSIEAGALSAVRQQEPLGLGHAIWCAR
SFIGDDPFAILLPDDVVKSDVPCLKQLVDVYNQTGGNVLAVTEVPREHTNRYGILKTGED
DGRLVEVKGLVEKPKPEDAPSNLSIIGRYILTADVMPHLSKLERGAGGEVQLTDAMAKVI
GHAPFHGLRYEGRRFDCGNKVGYLEAQIAFSIDRPDLGDAVRAFLKNYTG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaaacccttgcgaaaagccgtacttcctgttgccggccttggtacgcgctttctt
cctgcgaccaaggcgatgccgaaggaaatgctgcccgtcgtcgacagaccgctgatccag
tatgcgatcgatgaggcccgcgcggccggaatcgaggaattctgcctgatcaccggtcgc
ggtaaggattcgctgatcgattatttcgacgtcgccttcgaactggagacgacgctgcgc
gagcgcaacaagctggacgcgctggaagccctgggccccaccagcatcgaggccggggcg
ctgagcgccgtccgccagcaggaaccgctgggcctgggccatgcgatctggtgcgcgcgc
agcttcatcggtgacgatcccttcgccatcctgctgcccgacgacgtggtcaagagtgac
gtgccgtgcctgaagcaactggtcgacgtctataaccagaccggcggcaatgtgctggcg
gtaaccgaggtcccgcgcgaacacaccaatcgctacggcatcctgaagaccggcgaggat
gacgggcgcctggtcgaggtcaagggactggtcgaaaaaccgaagcccgaggatgcgccg
tccaacctgtcgatcatcgggcgctatatcctgacggcggacgtcatgccgcacctgtcg
aagctggaacgcggcgcgggcggcgaggtccagttgaccgacgccatggccaaggtcatc
ggccacgcgccgttccatggcctgcgctacgagggccgccgcttcgattgcggcaacaag
gtcggctacctggaggcgcagatcgccttttcgatcgaccgtccggacctgggtgacgcg
gtgcgcgcgttcctgaaaaactataccggctga

DBGET integrated database retrieval system