KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_0154Help
Entry
Gdia_0154         CDS       T00798                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gdia_0154
   01230 Biosynthesis of amino acids
    Gdia_0154
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gdia_0154
   00051 Fructose and mannose metabolism
    Gdia_0154
   00562 Inositol phosphate metabolism
    Gdia_0154
Enzymes [BR:gdj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Gdia_0154
Exosome [BR:gdj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Gdia_0154
  Exosomal proteins of bladder cancer cells
   Gdia_0154
  Exosomal proteins of melanoma cells
   Gdia_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(167508..168251)
Genome map
AA seq 247 aa AA seqDB search
MRQMIVGNWKMNGLGAPSRDLVGEIAEGLATIPSPPQVVVCPPFTQLAGIGPLLKGSGIA
LGAQDCHQAASGAHTGDISAAMLADLGVEYVVLGHSERRRDHGELDETVREKTQTALAAG
LTPIVCIGETGDQKASGESRDAIGWQIQGSLPDGFSGVVAYEPVWAIGSGNPAASQDIAD
MMGFIRAELVRQFGAAGKTIRILYGGSVNGRDAASILPIAEVGGALVGSASLQADTFLPI
VRAAVDL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagatgatcgtcggcaactggaagatgaacggactgggcgccccttcgcgcgac
ctggtcggggagatcgcggagggcctggccaccatcccctcgcctccgcaggtcgtggtc
tgtcccccgttcacccaactggccgggatcggccccctcctgaagggcagcggcatcgca
ctgggggcgcaggactgccatcaggcggcgtcgggcgcgcataccggcgacatatccgcc
gccatgcttgccgaccttggcgtggaatatgtcgtgctgggtcattccgaacggcgccgc
gaccacggcgagctggacgagacggtgcgcgagaagacgcagaccgccctggccgccgga
ctgaccccgatcgtctgcatcggagagaccggcgaccagaaggcgtccggcgaaagccgc
gacgcgatcggctggcagatccagggatcgctgcccgacggtttcagcggcgtcgtggcc
tacgagcccgtatgggcgatcggatcgggcaacccggccgccagccaggacatcgcggac
atgatgggcttcatccgcgccgagctggtgcgtcagttcggtgcggctggaaaaacgatt
cggatcctttatggtggatcggtcaacgggcgcgacgcggcgtccatcctgccgatcgcc
gaggtcggcggcgcgctggtcggcagcgcaagcctgcaggccgacacgtttctgccgatt
gtgcgggccgccgtggacctgtaa

DBGET integrated database retrieval system