KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_0163Help
Entry
Gdia_0163         CDS       T00798                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00010  Glycolysis / Gluconeogenesis
gdj00020  Citrate cycle (TCA cycle)
gdj00620  Pyruvate metabolism
gdj01100  Metabolic pathways
gdj01110  Biosynthesis of secondary metabolites
gdj01120  Microbial metabolism in diverse environments
gdj01130  Biosynthesis of antibiotics
gdj01200  Carbon metabolism
Module
gdj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gdia_0163
   00020 Citrate cycle (TCA cycle)
    Gdia_0163
   00620 Pyruvate metabolism
    Gdia_0163
Enzymes [BR:gdj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Gdia_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACI49963
JGI: Gdia0163
UniProt: A9HJB2
Position
177727..179001
Genome map
AA seq 424 aa AA seqDB search
MSVNILMPALSPTMTEGKLSRWLKKEGDAIHSGDVIAEIETDKATMEVEAVDDGLLGRIL
VSEGTEGVKVNAPIAIVVAEGESVPDDAAPVAAAPAAAPVAAAPVSEAKAPAIAAAPAVP
QGAAPAPAQGTRVFASPLARRIAAQKGIDLSGVKGSGPNGRIVRRDVESATAAPVAAPVP
SPAPSAPAAAIEAPHTAVPNSTIRKVIARRLTEAKSTIPHFYVAMDVELDALLDLRAKLN
AASPAEGPGAFKLSVNDMLIKAVAVTLRRVPKVNASYTEDATILYDDVDVSVAVSIADGL
ITPIVRQADRKSLREISEDAKDLITRARAGKLKPQEFQGGSFSISNMGMYGVKEFSAIIN
PPQAAILAIAAAEKRAVVKDDAIRIATVMTVTLSVDHRVVDGALAAEWVSTFRSVVESPL
SLVV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaatatcctgatgccggcgctgtcgccgacgatgaccgagggcaagctgtcc
cgctggctgaagaaggaaggcgacgcgatccattccggcgacgtgatcgccgagatcgag
accgacaaggcgacgatggaggtcgaggccgtggatgacggcctgctgggccgcatcctg
gtttccgaaggcaccgaaggggtgaaggtcaacgcgccgatcgccatcgtggtggcggaa
ggcgagagcgttcccgatgacgcagcccccgtggcggctgctccggcggcggctcccgtg
gcggcggccccggtttccgaggccaaggcaccggcgatcgcggccgccccggccgtgccc
cagggcgcggcgccggctccggcccagggcacgcgcgtcttcgcgtcgccgttggcgcgg
cgcatcgcggcgcagaaggggatcgacctgtccggcgtgaagggcagcggcccgaatggc
cggatcgtgcgtcgcgacgtcgaatccgcgacggcggcgcccgtggcggccccggtacca
tccccggcaccgtccgccccggccgcagcgatcgaggcgccgcataccgccgtgccgaac
tcgaccatccgcaaggtcatcgcccggcggctgaccgaggcgaagtcgaccatcccgcat
ttctacgtggcgatggatgtggaactggacgcgctgctggacctgcgggcgaagctgaac
gcggcctcgccggccgaggggccgggagcgttcaagctgtcggtcaacgacatgctgatc
aaggcggtggcggtaaccctgcgccgggtgccgaaggtcaatgcatcctataccgaggac
gcgacgatcctgtacgacgatgtcgatgtctcggtcgccgtgtcgatcgccgatgggctg
atcacgccgatcgtgcgccaggccgaccgcaagtcgctgcgcgagatcagcgaggacgcg
aaggatctgatcacccgcgcccgtgccggcaagctgaagccgcaggaatttcagggcgga
tcgttctcgatctcgaacatgggcatgtatggggtgaaggaattctcggccatcatcaat
ccgccccaggccgccatcctggccatcgcggcggctgagaagcgcgccgtggtcaaggac
gacgcaatccggatcgccaccgtgatgacggtgacgctgtcggtcgatcatcgcgtcgtc
gacggcgccctggccgccgaatgggtttcgaccttccgctcggtggtcgaatcgccgctg
agcctggtggtctga

DBGET integrated database retrieval system