KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_0163Help
Entry
Gdia_0163         CDS       T00798                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gdia_0163
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gdia_0163
   00020 Citrate cycle (TCA cycle)
    Gdia_0163
   00620 Pyruvate metabolism
    Gdia_0163
Enzymes [BR:gdj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Gdia_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
177727..179001
Genome map
AA seq 424 aa AA seqDB search
MSVNILMPALSPTMTEGKLSRWLKKEGDAIHSGDVIAEIETDKATMEVEAVDDGLLGRIL
VSEGTEGVKVNAPIAIVVAEGESVPDDAAPVAAAPAAAPVAAAPVSEAKAPAIAAAPAVP
QGAAPAPAQGTRVFASPLARRIAAQKGIDLSGVKGSGPNGRIVRRDVESATAAPVAAPVP
SPAPSAPAAAIEAPHTAVPNSTIRKVIARRLTEAKSTIPHFYVAMDVELDALLDLRAKLN
AASPAEGPGAFKLSVNDMLIKAVAVTLRRVPKVNASYTEDATILYDDVDVSVAVSIADGL
ITPIVRQADRKSLREISEDAKDLITRARAGKLKPQEFQGGSFSISNMGMYGVKEFSAIIN
PPQAAILAIAAAEKRAVVKDDAIRIATVMTVTLSVDHRVVDGALAAEWVSTFRSVVESPL
SLVV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaatatcctgatgccggcgctgtcgccgacgatgaccgagggcaagctgtcc
cgctggctgaagaaggaaggcgacgcgatccattccggcgacgtgatcgccgagatcgag
accgacaaggcgacgatggaggtcgaggccgtggatgacggcctgctgggccgcatcctg
gtttccgaaggcaccgaaggggtgaaggtcaacgcgccgatcgccatcgtggtggcggaa
ggcgagagcgttcccgatgacgcagcccccgtggcggctgctccggcggcggctcccgtg
gcggcggccccggtttccgaggccaaggcaccggcgatcgcggccgccccggccgtgccc
cagggcgcggcgccggctccggcccagggcacgcgcgtcttcgcgtcgccgttggcgcgg
cgcatcgcggcgcagaaggggatcgacctgtccggcgtgaagggcagcggcccgaatggc
cggatcgtgcgtcgcgacgtcgaatccgcgacggcggcgcccgtggcggccccggtacca
tccccggcaccgtccgccccggccgcagcgatcgaggcgccgcataccgccgtgccgaac
tcgaccatccgcaaggtcatcgcccggcggctgaccgaggcgaagtcgaccatcccgcat
ttctacgtggcgatggatgtggaactggacgcgctgctggacctgcgggcgaagctgaac
gcggcctcgccggccgaggggccgggagcgttcaagctgtcggtcaacgacatgctgatc
aaggcggtggcggtaaccctgcgccgggtgccgaaggtcaatgcatcctataccgaggac
gcgacgatcctgtacgacgatgtcgatgtctcggtcgccgtgtcgatcgccgatgggctg
atcacgccgatcgtgcgccaggccgaccgcaagtcgctgcgcgagatcagcgaggacgcg
aaggatctgatcacccgcgcccgtgccggcaagctgaagccgcaggaatttcagggcgga
tcgttctcgatctcgaacatgggcatgtatggggtgaaggaattctcggccatcatcaat
ccgccccaggccgccatcctggccatcgcggcggctgagaagcgcgccgtggtcaaggac
gacgcaatccggatcgccaccgtgatgacggtgacgctgtcggtcgatcatcgcgtcgtc
gacggcgccctggccgccgaatgggtttcgaccttccgctcggtggtcgaatcgccgctg
agcctggtggtctga

DBGET integrated database retrieval system