KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_0285Help
Entry
Gdia_0285         CDS       T00798                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Brite
Enzymes [BR:gdj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Gdia_0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(314367..315788)
Genome map
AA seq 473 aa AA seqDB search
MSVRKLVLSVAALGCVAYGGTVGYLTHFDHDTAPTLGTNSPTLADPVASAAFAAIRESRC
DYCHARNTDLPFYFHVPVANQLMQRDVDQGLRHFRIEPVLAAFQSGAVPSEEQLARIEEV
VRQNRMPPTLYLLLHWHAHLSQAQRDALLTWIAAERRAHYATPGVAPRFAAEPVQPVPET
LPVDAAKVALGQRLFFDKQLSGDGTLNCASCHALDHGGVDGRVTALGIDNRHGPINVPTV
YDAAFNQSQFWNGRAATLADQAAGPVMNPLEMGSHDWTGVADKLKQDPTYLTAFQGVFGS
DEITRDRITDAIAEYEKTLITPDSRFDRYLKGDDQALNAQEKNGYALFKSVGCSGCHTGV
SLGGQAFEAMGLEGDYFAARGGTLTDADKGRYMVTHSDADMERFKVPNLRNIALTAPYFH
DGSVKTLDQAVREMARYQTPDHDLSDHDVADIVAFLQTLTGTYQGHQLAETTH
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtgcgcaagctcgtactatcagtggcggccctgggctgcgtcgcctatggcgga
acagtggggtatctgacccatttcgaccatgacaccgcgccgacattgggcacgaattct
ccaacactggccgatccggtcgcctcggcggccttcgccgcgattcgcgaatcccggtgc
gactactgccatgcccgcaataccgacctgccgttctatttccatgtgccggtggcgaac
cagttgatgcagcgcgacgtggaccagggcctgcgtcatttccggatcgagcccgtgctg
gccgcgttccagagcggcgccgttccgtccgaggaacaactggcgcggatcgaggaagtg
gtgcgccagaaccgcatgccgccgaccctgtacctgctgctgcactggcacgcccatctg
tcgcaggcgcagcgtgacgcgctgctgacctggatcgcggcggaacggcgcgcgcattac
gcgaccccgggggtcgccccacgcttcgcggccgaaccggtgcagccggtgcccgagacg
ctgccggtggatgcggccaaggtcgcgctgggccagcgcctgttcttcgacaagcaattg
tcgggggacggcaccctcaattgcgccagttgccatgcgctggaccatggcggcgtggac
ggccgggtcacggcgctgggcatcgacaaccgccacggcccgatcaacgtgcccaccgtc
tatgacgccgcgttcaatcagagccagttctggaacggccgcgccgcgaccctggccgac
caggcggcgggaccggtgatgaacccgctggaaatgggatcgcacgactggaccggcgtg
gccgacaagctgaagcaggaccccacctacctcaccgcgttccagggcgtcttcggctcg
gacgagatcaccagggaccggatcacggatgcgatcgcggaatatgaaaagaccctgatc
acccccgacagccgcttcgaccgctacctgaagggcgacgaccaggccctgaacgcgcag
gaaaagaacggctacgcgctgttcaagagcgtgggatgctcgggctgccacaccggcgtc
tcgctgggcgggcaggcgttcgaggcgatgggcctggagggcgattacttcgccgcgcgc
ggcggcacgctgaccgatgccgacaagggacgctatatggtgacccattcggacgccgac
atggaacgcttcaaggtgccgaacctgcgcaacatcgccctgaccgcgccgtatttccat
gacggcagcgtcaagacgctggaccaggcagtgcgggaaatggcgcgctaccagacgccc
gatcacgacctgtcggaccacgacgtggccgatatcgtggccttcctccagaccctgacc
ggcacctaccagggccaccaactggctgaaaccacgcactga

DBGET integrated database retrieval system