KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_0567Help
Entry
Gdia_0567         CDS       T00798                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Brite
Enzymes [BR:gdj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Gdia_0567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
632888..633166
Genome map
AA seq 92 aa AA seqDB search
MAQMAPEVVSLQNEITTACMPQILTDSQLTALTSFAYNVGFDAFRGSTLHRFILAGNMTG
AAGQFVLWDKADGEVVQGLLDRRIKERDIFLS
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggcacagatggcaccagaggtagtgtccctccagaatgaaatcacaacggcctgtatg
ccgcagatcctgactgatagtcagcttaccgccctgacatcatttgcctacaacgtggga
ttcgatgcctttaggggatcaactcttcataggttcatcctagctgggaatatgacaggg
gcggctggtcagtttgttttatgggacaaagctgatggcgaggtggttcagggtcttctg
gacagacgtattaaagagcgtgatatttttctgtcttaa

DBGET integrated database retrieval system