KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_0698Help
Entry
Gdia_0698         CDS       T00798                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gdia_0698
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Gdia_0698
Enzymes [BR:gdj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Gdia_0698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
792502..793809
Genome map
AA seq 435 aa AA seqDB search
MSIDTIAAFMADPERFAGIKRDYDARDVATLSGSFRIRHTLAEMGAARLWHLLKTEPYIN
ALGALTGNQAMQQVKAGLKAIYLSGWQVAADANVAGEMYPDQSLYPVNSVPTVVRRINNA
LRRCDEIATQEGDRGQYWMAPIVADAEAGFGGPLNVFELMRALIAAGAAGVHFEDQLASE
KKCGHLGGKVLIPIAQHIRSLNAARLAADVEGVPTVLICRTDSHAAQLLTSDIDERDHPF
LTGERTREGFFRIREGLGVEYAIARSLAYAPYCDLLWWETSEPNLEEARQFAEAIHKQFP
GKMLAYNCSPSFNWKKKLSARDIADFQRRIGAMGYKFQFVTLAGFHSLNYSMFKLAHGYA
ERGMAAYSELQEAEFSAEVDGYTATRHQREVGTGWFDAVATVAGGGHTSTAAMAGSTETK
QFHADLSFDRNKTPV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgacaccattgccgccttcatggccgaccccgagcgcttcgcgggcatcaag
cgcgattatgacgcgcgcgacgtggcgacgctctccggctcgttccgcatccgccacacc
ctggctgaaatgggtgccgcgcgcctgtggcacctgctgaagaccgaaccctacatcaac
gcgctgggcgcgctgacgggcaaccaggcgatgcagcaggtcaaggcggggctgaaggcc
atctacctgtccggctggcaggtcgcggccgacgccaacgtggcgggcgagatgtatccc
gaccagtcgctgtaccccgtgaattcggtgcccaccgtggtgcggcgcatcaacaacgcc
ctgcgccgctgtgacgagatcgcgacgcaggagggcgatcgcggccagtactggatggcc
cccatcgtcgcggatgccgaggccgggttcggcggcccgctgaacgtcttcgagctgatg
cgcgccctgatcgcggccggcgcggcgggcgtgcatttcgaggaccagttggcctcggaa
aagaaatgcggccatctgggcggcaaggtgctgatcccgatcgcgcagcatatccgctcg
ctgaacgcggcgcggctggcggcggatgtcgagggggtgcccacggtcctgatctgccgc
accgacagccacgcggcgcagctcctgacctcggacatcgacgagcgcgaccatccgttc
ctgaccggcgagcgcacgcgggaaggcttcttccgcatccgcgaggggctgggcgtcgaa
tacgccatcgcccgttcgctggcctatgcgccctattgcgacctgctgtggtgggagacg
tccgagccgaacctggaggaagcccggcagttcgccgaggccatccacaagcagttcccc
ggcaagatgctggcctataactgctcgccgtccttcaactggaagaagaagctgtcggcg
cgcgacatcgcggacttccagcgccggatcggggcgatgggctacaagttccagttcgtc
accctggcgggcttccacagcctgaactattcgatgttcaagctggcgcatggctacgcg
gaacgcggcatggccgcctattccgagttgcaggaagccgagttcagcgccgaggtcgac
ggctacaccgccacccgccaccagcgcgaggtcgggaccggctggttcgacgcggtcgcg
accgtggccggcggcggccatacctcgaccgccgcgatggccggttcgaccgagaccaag
cagttccatgccgacctgtccttcgaccggaacaagacgccggtctga

DBGET integrated database retrieval system