KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_0699Help
Entry
Gdia_0699         CDS       T00798                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gdj01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gdj00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:gdj00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
793930..796143
Genome map
AA seq 737 aa AA seqDB search
MSRRTIGQLRIHHALDAFVTHEVLPGTGVSADRFWMGLSDIITHFTPKILNALARRRLLQ
QAVDHLLTAPGFDPGDVGAQIDLLRTVGYLEREPESVSIATRDVDAEIARIAGPQLVVPV
TNARYALNAANARWGSLYDAFYGTDAEPYDMQGVPTAGYDTQRGERVIRRVRLLLDEIMP
LTRGSHADVARYRVEDGRLTAALDDGAPPAGLRRPAQFAGFQGPPDAPRVVLLRNHGLHL
ELRFDPTSPIGSRDRAGISDVIAESAISTIMDCEDSVSAVDVEDKIQVYRNWLGLMQGTL
TASFRKGGRLLERRLAPDRHYTAPDGTPLVLPGRSLMLIRNVGHHMFTDAIVDTGGHPVP
EGVLDAAVTAAIALHDLRGTSRTTNSRTGSIYIVKPKMHGPEEVALSDALFARVERVLGL
GPNTIKMGIMDEERRTSANLAACIQAARERVVFINTGFLDRTGDEIHYCMQAGPVVRKAD
MRAEPWMAAYEQRNVAIGLACGLKDHAQIGKGMWAMPDRMADMMTQKIAHPRAGANTAWV
PSPTAATLHALHYHFVDVATVQARMENVPPAAIKGLMTLPLADPAAWSAAERRAELDNNL
QGILGYVVRWVDMGIGCSKVPDLDDVGLMEDRATLRISSQHVANWLHHGVVSQDEVRASM
IRMAAIVDGQNRDEPGYRPLADNAGGPAFRAASDLVFKGVTQPNGYTESTLHRWRRVAKN
GAAAANRTVPELDRAVP
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtcgcacgatcggccagcttcgcatccatcatgccctcgatgccttcgtcacg
cacgaagtcctgccgggaaccggcgtttccgccgaccggttctggatgggcctgtcggac
atcatcacccatttcacgccgaagatcctgaacgccctggcgcgccgccgcctgttgcag
caggccgtggaccatctgctgaccgcacccggattcgatcccggcgatgtcggcgcgcag
atcgacctgctgcgcaccgtcggctatctggagcgcgagccggagagcgtgtcgatcgcc
acccgtgacgtcgatgccgaaatcgcgcgcatcgccgggccccagcttgtggttcccgtc
accaacgcccgctatgcgctgaatgccgccaacgcccgctggggcagcctgtatgacgcg
ttctacggcaccgacgccgagccgtacgacatgcaaggcgttcccaccgccggctatgac
acgcagcgcggcgagcgggtgatccggcgggtacggctgctgctggacgaaatcatgccg
ctgacgcgcggcagccacgccgacgtcgcgcgctatcgggtcgaggacggccggttgacg
gcggcgctcgacgacggcgcgccgccggccggcctgcgccgtccggcacagttcgccgga
ttccagggaccgccggacgcgccccgggtggtcctgctgcgcaatcacggcctgcatctg
gaactgcgcttcgacccgacatcgccgatcggcagccgggaccgcgccgggatatccgac
gtgatcgcggaatccgcgatcagcaccatcatggattgcgaggacagcgtttcggcagtc
gatgtcgaggacaagatccaggtctatcgcaactggctgggcctgatgcagggcaccctg
accgcgtcgttccgcaagggcgggcgcctgctggaacggcgcctggcccccgaccggcat
tacaccgcgcccgacggcacgccgctggtgctgccggggcgcagcctgatgctgatccgc
aatgtcggccaccacatgttcaccgatgcgatcgtggacactggcggccacccggtgccc
gagggcgtgctggacgccgccgtgaccgccgccatcgccctgcacgacctgcgcggaacg
tcgcgcaccaccaacagccggacgggatcgatctatatcgtcaagcccaagatgcacggg
ccggaagaggtcgccttgtccgacgccctgttcgcgcgcgtcgaacgggtgctgggcctg
gggccgaacaccatcaagatgggcatcatggacgaggaacggcggaccagcgccaacctg
gccgcgtgcatccaggccgcgcgcgagcgggtggtgttcatcaataccggtttcctggac
cgcacgggggacgagatccattactgcatgcaggccggccccgtggtgcgcaaggccgac
atgcgcgccgagccgtggatggcggcatacgaacagcgcaacgtcgcgatcggcctggcc
tgcgggctgaaggaccatgcccagatcggcaagggcatgtgggcgatgccggaccgcatg
gccgacatgatgacccagaagatcgcccacccccgcgcgggcgccaatacggcctgggtg
ccctcgcccaccgcggcgacgctgcatgcgctgcattatcacttcgtcgacgtggcgacg
gtgcaggcgcggatggaaaacgtgccgccggccgccatcaaggggctgatgaccctgccg
ctggccgatccggcggcgtggtcggcggcggagcgccgggccgaactggacaacaacctg
cagggcatcctgggttatgtcgtccggtgggtggatatgggcatcggctgttccaaggtg
ccggacctggacgatgtcggcctgatggaggaccgcgcgacgctgcgcatttcctcgcag
cacgtcgcgaactggctgcatcacggcgtggtgtcgcaagacgaggtccgggcgtccatg
atccgcatggccgccatcgtggacgggcagaatcgcgacgagcccggctatcgcccgctg
gccgacaacgcaggcggcccggccttccgcgccgcgtcggacctggtgttcaagggcgtg
acccagcccaacggctataccgagtccacgctgcatcgctggcgccgggtggccaagaac
ggcgccgccgcggcgaaccggacggtgccggaactggaccgggccgttccgtaa

DBGET integrated database retrieval system