KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_0720Help
Entry
Gdia_0720         CDS       T00798                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00010  Glycolysis / Gluconeogenesis
gdj00071  Fatty acid degradation
gdj00350  Tyrosine metabolism
gdj00625  Chloroalkane and chloroalkene degradation
gdj00626  Naphthalene degradation
gdj01100  Metabolic pathways
gdj01110  Biosynthesis of secondary metabolites
gdj01120  Microbial metabolism in diverse environments
gdj01130  Biosynthesis of antibiotics
gdj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gdia_0720
  Lipid metabolism
   00071 Fatty acid degradation
    Gdia_0720
  Amino acid metabolism
   00350 Tyrosine metabolism
    Gdia_0720
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Gdia_0720
   00626 Naphthalene degradation
    Gdia_0720
Enzymes [BR:gdj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Gdia_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N TrkA_N AlaDh_PNT_C 2-Hacid_dh_C adh_short 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACI50510
JGI: Gdia0720
UniProt: B5ZEB9
Position
complement(817622..818650)
Genome map
AA seq 342 aa AA seqDB search
MTGKMKAAVVREFGKPLTIEELDIPSIRPDQILVKMDACGVCHTDLHAARGDWPVKPNPP
FIPGHEGVGHVVSVGSAVKWVKLGDVVGVPWLYSACGHCEHCLGGWETLCASQDDTGYTV
NGCFAEYVVADPSYVAHLPKTIDPLQVAPVLCAGLTVYKGLKMTDTKPGDWVAVSGVGGL
GQMAVQYGVAMGMNVIAVDIDDEKLATAKALGAALTVNARATDPAPFIQSQVGGAHGALV
TAVSRSAFSQAMGFARRGGTIVLNGLPPGEFPISIFDMVMAGTTVRGSIVGTRLDMIEAV
SFFADGKVKTVIEPDRLENINQIFTDLEEGKIQGRKVLDFRQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaagatgaaggccgctgtcgttcgtgagttcggcaagccgctgacgatcgaa
gagctggatattccctcgatccggccggaccagatcctggtcaagatggacgcgtgcggc
gtctgccacaccgacctgcacgccgcccggggggactggcccgtgaagccgaatccgccc
ttcatcccggggcacgagggcgtgggccacgtcgtgtccgtgggcagcgcggtcaaatgg
gtcaagctgggcgatgtcgtcggcgtgccgtggctgtattcggcctgcggccattgcgag
cactgcctgggcgggtgggaaacgctgtgcgccagccaggacgataccggctacaccgtc
aatggctgcttcgccgaatatgtggtggccgatcccagttacgtcgcccacctgccgaag
acgatcgacccgctgcaggtggcgcccgtgctctgtgccggcctgacggtctacaagggc
ctgaagatgaccgacaccaagccgggtgactgggtcgcggtgtcgggtgtcggcgggctg
ggccagatggcggtgcaatacggcgtcgccatggggatgaacgtcatcgccgtcgatatc
gacgacgaaaagctggccacggcaaaggccctgggcgcggcgctgacggtgaacgcgcgc
gccaccgatcccgcccccttcatccagtcgcaggtcggcggcgcccatggcgcgctggtc
acggccgtgtcgcgcagcgcgttctcgcaggcgatgggctttgcccgccggggcggcacg
atcgtgctgaacgggctgccgccgggggaattcccgatttccatcttcgacatggtcatg
gccgggaccacggtgcgcggatcgatcgtcggcacgcggctggacatgatcgaggcggtg
tccttcttcgccgacggcaaggtcaagacggtgatcgagcccgaccggctggaaaacatc
aaccagatcttcaccgacctggaagaaggcaagatccagggacgcaaggtgctggatttc
cgccagtaa

DBGET integrated database retrieval system