KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_0779Help
Entry
Gdia_0779         CDS       T00798                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gdia_0779
Enzymes [BR:gdj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Gdia_0779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(887557..888567)
Genome map
AA seq 336 aa AA seqDB search
MRIIQLPMRSTALALLLLAGAMPARAQDYKGVNLAGAAYSSNKIPGRYGYDYLFPKPGEV
TYFHDRGMNIFRLSVLWERLQPAPGVALDSGYMGRINGFVDQVHAVGGKVILDIHDYGRY
RGTLIGDGQVTAADFRDLWTRLGTAFRDRPDVWFGLMNEPQQKSAEAWRDIEQQAILGIR
AAGARNPILVSGVGWDAAHGFATVNAPALATLKDPDHSLVFEVHEYFDPDSSGRSPDCIP
TDQAVARLASFTAWLHQTGNKGFLGEFGVGRSAACLDVLDKVASYLAANQAVWLGWTYWA
AGPLWGEYMYTLEPTKTGQDRPQMLVLDRYLTHRGR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattatacaattgcccatgcgatcgaccgccctggcgctgctgctgctcgcgggg
gcgatgccggcccgggcccaggactacaagggtgtgaacctggccggggcggcctattcg
tcgaacaagatcccgggtcgctacggctacgactatctgtttcccaagccgggcgaggtc
acgtacttccatgaccgggggatgaatatctttcgcctgtccgttctgtgggaacggctg
cagcccgcgccgggggtggcgctggattccggttatatgggccgcatcaacgggttcgtg
gaccaggtccacgcggtgggcggcaaggtcatcctcgatatccacgattatggccgctat
cgcggcacgctgatcggcgacggccaggtgaccgccgccgattttcgcgacctgtggacc
cgcctggggaccgcgttccgcgaccggccggatgtctggttcggcctgatgaacgaaccg
cagcagaaatcggccgaggcgtggcgcgatatcgaacagcaggcgatcctgggcattcgc
gcggcgggggcccggaacccgatcctggtatcgggcgttggctgggacgccgcccatggt
ttcgcaaccgtaaatgctccggccctggccacgctgaaggaccccgaccattccctggtg
ttcgaagtccatgaatatttcgatcccgacagttcgggccgcagcccggactgcatcccg
accgatcaggcggtcgcgcggctggcctccttcaccgcatggctgcaccagacgggaaac
aagggcttcctgggcgaattcggcgtcggccgcagcgcggcctgcctggatgtcctggac
aaggtcgcatcctatctggcggccaaccaggcggtctggctcggctggacctactgggcc
gccgggccgctgtggggcgaatacatgtatacgctggaaccgaccaagaccggacaggac
cggccgcagatgctcgtcctggaccgttacctgacccaccgggggagataa

DBGET integrated database retrieval system