KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_0993Help
Entry
Gdia_0993         CDS       T00798                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gdj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1116217..1118403)
Genome map
AA seq 728 aa AA seqDB search
MSGRATDSSPTEALAGLVERVTFHNAENGFCVLRVKVRGQRDLVTVVGHAAMISAGEFVQ
MSGRWFNDHTHGLQFKAEFLKASPPTTVEGIERYLGSGMIRGIGPVYAKKLVKAFGEAVF
DLIEQEPGRLREVTGIGPKRAERIVAGWADQKMIREIMLFLHSNGVGTSRAVRIFKTYGQ
DAVQLISENPYRLAKDIRGIGFKTADQIARKMGIAPDAMIRVRAGISYALGEAMDEGHCG
LPVGELLTSTAELLEVATPLIETALALELEAGDVIVDSVGETDCIFLAGLYRAEQSIAER
LRACAIGRPPWPDIDAEKAMSWVEGKIGLALAPSQQEAVRLALHSKVLVITGGPGVGKTT
LVNAILKIVTAKGTDVQLCAPTGRAAKRLSESTGLEGKTIHRLLETDPANGSFKRDDTNP
LTCDLLVVDEASMVDVLLMRSLLRALPDNAALLIVGDVDQLPSVGPGQVLADIIGSDAVP
VVRLTEVFRQAAQSRIITNAHRINEGRMPELNAEEGSDFYFVEAAEPEIGLRRLLAVVKD
RIPARFGLDPVRDVQVLCPMNRGGLGARSLNIELQQALNPPGDVKVERFGWTYGPGDKVM
QIANDYDRDVFNGDLGVIDRIDVEEGELTVSFDGREVVYGFGELDELVLAYATTIHKSQG
SEYPAVVIPLVTQHYAMLARNLLYTGVTRGRKLVVLVGQKKALAIAVRNQGGRRRWSKLR
EWLAGSIA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgagtggacgcgccaccgactcttcgcccacggaagcgctggccggcctcgtggagcgg
gtgacgttccacaatgccgagaacggcttctgcgttctgcgggtgaaggtgcgggggcag
cgcgatctggtcactgttgtcggccatgccgccatgatctcggcgggcgagttcgtgcag
atgtcgggccgctggttcaacgatcacacccacggccttcagttcaaggccgagtttctc
aaggccagcccgccgaccacggtcgagggcatcgagcgttatcttggttcgggcatgatc
cggggcattggtcccgtctatgcgaagaagctggtgaaagcgttcggcgaggccgtgttc
gatctgatcgagcaggaaccgggacggctgcgggaggtgacgggcatcggccccaagcgc
gcggagcggattgtcgctggctgggcggaccagaagatgatccgcgagatcatgctgttc
ctgcacagcaatggcgtcggcacctcgcgggcggtaaggatcttcaagacctatggtcag
gatgcggtccaactgatcagcgagaacccctatcggctcgcgaaggacatccgggggatc
gggttcaagaccgccgaccagatcgcccggaagatgggcatcgcgcctgacgccatgatc
cgggtgagggccgggatctcctacgcgcttggcgaggcgatggatgaagggcattgcggc
ctgccagtcggggagctgctgaccagcactgccgaactgctggaggtcgccacccctctg
atcgagacggccctcgcgctggagctggaagcgggcgacgttattgtcgacagcgtgggc
gagacggactgtatcttcctcgccggcctgtaccgcgcggagcagagcatcgcggagcga
ttgcgcgcctgcgccattggccgtccgccctggccggacatcgacgctgaaaaggccatg
tcctgggtggagggcaagatcgggcttgcgctcgcgcccagccagcaggaggcggtgcgc
cttgccctgcacagcaaggtgctggtgatcacgggcggacccggcgtgggcaagacaacg
ctggtcaacgccatcctcaagatcgtgacggccaagggcacggatgtgcagctctgcgcg
ccgaccggtcgcgcggcgaagcgcctgtcggaaagcacggggctggaaggcaagaccatc
caccgcctgctggagacggatccggccaatggcagtttcaaacgggacgataccaacccg
ctgacctgcgatctgctggtcgtggacgaggccagcatggtggacgtgctgctgatgcgc
tccctgctgcgcgcgctgcccgacaacgccgcgttgttgatcgtaggcgacgtggaccag
ttgccttctgtcgggccggggcaggtgctggccgacatcatcggctccgatgccgtgcct
gtggtgcggctgaccgaggtgttccgccaggcggcacagagccggatcattaccaatgcg
caccggatcaacgagggcaggatgcccgaactgaacgcggaagagggatcggatttctat
ttcgtagaggccgccgagccggagatcgggctgcgtcggctgctggccgtggtgaaagac
cgtatcccggcgcggttcgggctggacccggtccgcgatgtgcaggtgctttgcccgatg
aaccggggcgggcttggggcgcggtcgctgaatatcgaattgcagcaggcgctgaacccg
ccgggcgacgtgaaggttgagcggttcggctggacctatggtcccggcgacaaggtgatg
cagatcgccaatgattatgaccgggacgtcttcaacggggatcttggcgttatcgatagg
atcgatgtggaagagggcgaactgacggtctcattcgatggacgggaggtcgtttacggc
tttggagaactggacgaactggtgctggcctacgcgaccaccattcacaagagccaggga
tcggaatatccagcggtggtcatccccctggtgacgcagcattacgctatgctggcgcgg
aacctgctctataccggcgtcacacgcgggcggaagctcgtcgtgctcgtggggcagaag
aaggcgctggccatcgccgtgcgcaaccagggcgggaggcggcggtggtcgaagctcagg
gagtggctggcgggtagcatcgcatga

DBGET integrated database retrieval system