KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_1118Help
Entry
Gdia_1118         CDS       T00798                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Gdia_1118
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gdia_1118
  Lipid metabolism
   00071 Fatty acid degradation
    Gdia_1118
  Amino acid metabolism
   00350 Tyrosine metabolism
    Gdia_1118
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Gdia_1118
   00626 Naphthalene degradation
    Gdia_1118
Enzymes [BR:gdj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Gdia_1118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1255759..1256748
Genome map
AA seq 329 aa AA seqDB search
MMHAMRLNAPHTDLEWVELPDRLPGPGEIRVRVGACGVCRTDLHVVDGDLPFPGHPVIPG
HEIVGRIEALGEGVQDLKIGQRVGVPWLGHTCGICRYCHSGHENLCDHPLFTGYTRDGGY
ATAAIADARYAFPLGEEGSDVDLAPLLCAGLIGWRSLVMAGEDAKTVGLYGFGAAAHIIA
QVALWQGRTVYGFTRPGDRPTQDFARSLGATWAGGSDEAPPEKLDAAIIFAPVGALVPAA
LRAVRKGGRVVCAGIHMSDIPSFPYDLFWEERQLVSVANLTRQDGIDFLSLAPRIGVRTK
TTRYDLRDANRALADLRAGRFEGAAVLVP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgatgcacgcgatgcgattgaatgccccgcataccgacctggaatgggtggaactgccc
gaccgcctgcccggccccggcgagatccgggtgcgcgtcggggcctgcggcgtgtgccgc
accgacctgcacgtggtggatggcgacctgccctttcccggccatccggtcattccgggg
cacgagatcgtgggccggatcgaggcgctgggcgagggtgtgcaggacctgaagatcggc
cagcgggtcggcgtgccgtggctgggccatacctgcggcatctgccgctactgccacagc
gggcatgaaaacctgtgcgaccatccgcttttcaccggctacacccgcgacggcggctat
gccaccgccgccatcgccgatgcccgctatgcgtttccgctgggcgaggaaggcagcgac
gtggacctggcccccctgctgtgcgcggggctgatcggctggcggtcgctggtgatggcg
ggcgaggacgcgaagacggtggggctgtacggcttcggcgccgccgcgcacatcatcgcc
caggtggcgctgtggcagggccgcaccgtctatggcttcacccgcccgggcgaccgcccg
acgcaggatttcgcccggtcgctgggcgcgacctgggccggcggatcggacgaggcgccg
ccggagaagctggacgccgccatcatcttcgcccccgtgggcgcgctggttccggcggcc
ctgcgcgcggtgcgcaagggcggccgcgtggtctgtgccggtatccacatgagcgacatc
cccagcttcccctacgatttgttttgggaggaacggcaactggtttcggtcgccaacctg
acacggcaggacggtatcgatttcctctcgctggcgcccaggatcggcgtccgcaccaag
acgacgcgctatgacctgcgcgatgccaaccgcgcgctggccgacctgcgggccggacgg
ttcgagggcgcggcggtgctggtgccctga

DBGET integrated database retrieval system