KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_1153Help
Entry
Gdia_1153         CDS       T00798                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gdia_1153
   00052 Galactose metabolism
    Gdia_1153
Enzymes [BR:gdj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Gdia_1153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1290405..1291613)
Genome map
AA seq 402 aa AA seqDB search
MLRISPTRLATSLLAATALVSATLASATPVRAADAPVALARAGFGTMADGKPVEILTLRN
AHGVSVRFITYGGIITAIDTPDRTGHTDDIVLGFPDLQGYTVDSAQGGLFFGAMIGRYAN
RIARGTFTLDGATYHVPVTAPPNALHGGTRGFDKHLWTVDGTATDAHSASATLSLTSPDG
DQGFPGTLKVSVTYTLDDQDRLTLHYRATTDKPTVLNLTNHSYFNLGGEGSGSIEDEILQ
INADHFTPTDPTAIPTGDIAPVAGTPLDFRKPMRIGVHLRDSYPQLMFARGYDHNWVVNG
PAGAAPRPAAHIVDPRTGRTMDVLTSQPGLQVYTSNSLDGAYAGVSHRAYRQTDAIAFEA
EHYPDSPNHPSFPTTTLRPGETFDYTTIFHFGVQPAAPRHGQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaatctccccgacccgtcttgccacgtcgctgctggcggccacggccctggtg
tccgctaccctggcatccgccacgcccgtccgggcggccgatgccccggtcgcgctggcc
cgggccggcttcggcacgatggcggacggcaagccggtcgagattctgaccctgcgcaac
gcccatggtgtctcggtgcgcttcatcacctatggtggcatcatcaccgcgatcgacacg
cccgaccggaccggccacaccgacgatatcgtcctcggctttcccgacctgcagggctat
acggtggacagcgcccagggcggcctgttcttcggcgccatgatcggccgctacgccaac
cggatcgcgcgcggcaccttcaccctggacggcgcgacgtatcacgttcccgtgacggcg
ccgccgaatgcgctgcatggcggcaccaggggcttcgacaagcatctgtggaccgtcgac
ggcaccgccacggacgcccattcggccagcgccacgctgtcgctgaccagcccggatggg
gaccagggcttccccggcacgctgaaggtcagcgtgacctacacgctggacgaccaggac
cggctgacgctgcattatcgcgcgacgaccgacaagccgacggtgctgaacctgaccaac
cacagctacttcaacctgggcggcgagggatcgggctcgatcgaggatgaaatcctgcag
atcaacgccgatcacttcacccccaccgacccgacggcgattcccaccggggacattgcg
ccggtggccggcacgccgctggatttccgcaagccgatgcggatcggcgtgcatctgcgc
gattcctatccgcaactgatgttcgcgcgcggctacgaccataactgggtcgtcaacggc
ccggccggcgccgcaccccgtccggccgcccatatcgtggacccccggaccggccgcacg
atggacgtcctgacgtcgcagcccggcctgcaggtctatacgtcgaactcgctggatggg
gcctatgccggggtgtcgcatcgcgcctaccgccagaccgacgcgatcgcgttcgaggcc
gagcattatcccgattcgcccaaccatccgtccttccccaccaccacgctgcgcccgggc
gagacgttcgattacacgacgatcttccatttcggcgtgcagccggccgcaccccgtcac
ggacagtga

DBGET integrated database retrieval system