KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_1206Help
Entry
Gdia_1206         CDS       T00798                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00790  Folate biosynthesis
gdj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Gdia_1206
Enzymes [BR:gdj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Gdia_1206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACI50989
JGI: Gdia1206
UniProt: B5ZH22
Position
complement(1343386..1344459)
Genome map
AA seq 357 aa AA seqDB search
MDCLRLIEPVGLVLGRQAHVAVAAGLAHWLAGGPAAFTLARLIDGDDVRLVRAGDIPPGW
LPVLARVTAPLPSADLPDGPRVMGILNVTPDSFSDGGRHMGPDAALRAAAAMVEAGAALL
DIGGESTRPDAAVVTPDEEWARIAPVLADLHGRTGAVLSVDTRNARTMASALGLGATLIN
DVSALAHDPDALGVVADAGCPVVLMHMRGTPQTMSRLATYGDVGADVTRELAARIDAAVA
AGVARHRILVDPGIGFAKTTAQNAALLGRLPILANLGCRIVLGTSRKRTLGELAGVQVAA
DRDPGTVASTLPGLELGNTILRVHNVPAMVQALRVWQGVWTCDKPASGPAMAGQNQG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggattgtcttcggttgatcgaacccgtggggctggtcctggggcggcaggcgcatgtg
gccgtggcggcgggactggcccactggctggccggtgggccggcggcctttaccctggct
cggctgatcgacggggacgatgtccgcctggtccgcgcgggcgatattccgcccggctgg
ctgccggtcctggcccgtgtgacggcgccgctgccgtcggcggacctgccggacgggccg
cgggtgatgggcatcctgaacgtgacgccggacagcttcagcgacggtggccgccatatg
ggaccggacgccgcattgcgtgccgcggcggccatggtggaagccggtgccgcgctgctg
gatatcggcggcgagagcacgcggcccgacgccgccgtggtgacgccggacgaggaatgg
gcccgcatcgctccggtgctggcggacctgcacggccggaccggggccgtactgtcggtc
gacacccgcaacgcccgtaccatggcctccgcgctggggctgggggcgacgctgatcaac
gatgtctcggcgctggcgcatgacccggatgcgctgggggtggtggcggatgccgggtgc
cccgtggtgctgatgcatatgcgcggcacgccgcagacgatgtcgcgccttgcgacctat
ggcgacgtgggcgccgacgtgacgcgcgaactcgccgcgcgaatcgacgcggccgtggcc
gccggtgtcgcgcgccatcgcatcctcgtcgatcccggcatcggcttcgccaagaccacg
gcgcagaatgccgcattgctgggccggttgccgatcctggcgaacctggggtgccgtatc
gtgctgggaacgtcgcgcaagcgcacgctgggggaactggccggggtgcaggtggccgcc
gaccgcgatccggggaccgtggccagcaccctgccgggcctggaactcggcaacacgatc
ctgcgtgtacataacgtgccggccatggttcaggccctgcgggtctggcagggcgtgtgg
acctgcgataagccggcatcagggcccgccatggcagggcagaaccagggatag

DBGET integrated database retrieval system