KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_1238Help
Entry
Gdia_1238         CDS       T00798                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Gdia_1238
Enzymes [BR:gdj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Gdia_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1377828..1378445
Genome map
AA seq 205 aa AA seqDB search
MTPTDTVPLPRPSREEAEDAIRTLLRWAGEDPAREGLLDTPGRVVRSYEEFFQGYAEDPS
EILSRTFSEVDDYDEIVLLRDIRFESHCEHHMVPIIGVAHVAYLPGKRVVGISKLARVVE
AFSRRLQIQERLTAQIANTINDVLQPHGVAVILEAGHQCMTTRGVHRPGVSMVTSRMLGV
FRTNSDTRRELMAMLNRPSAATTHI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacccccaccgacacggttcccctgccccgtccctctcgcgaggaggcggaagacgcg
atccgcaccctgctacgctgggcgggcgaagatcccgcccgcgaagggctgctcgatacg
ccgggccgcgtagtgcggtcgtacgaggaattcttccagggctatgccgaggacccgtcc
gaaatcctgtcgcgcaccttctcggaagtcgatgactacgacgagatcgtgctgctgcgc
gacatccgtttcgaaagccattgcgagcaccacatggtgccgatcatcggcgtcgcgcat
gtcgcctacctgcccggcaagcgggtggtggggatttcgaaactggcgcgggtggtcgag
gccttttcccgccggctgcagatccaggaacgcctgacggcgcagatcgccaatacgatc
aacgatgtgctgcaaccgcatggcgtcgcggtgatcctggaggccgggcaccaatgcatg
accacgcgcggggtgcatcggcccggcgtatcgatggtgaccagccgcatgctgggggta
ttccgcaccaattcggatacgcggcgcgaactgatggcgatgctgaaccggccttcggcc
gccaccacccatatataa

DBGET integrated database retrieval system