KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_1464Help
Entry
Gdia_1464         CDS       T00798                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gdia_1464
Enzymes [BR:gdj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Gdia_1464
Exosome [BR:gdj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gdia_1464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1640187..1642415)
Genome map
AA seq 742 aa AA seqDB search
MNAARNDCTYTLPSGTEDLLAGTCPDPFSILGRHPHGRVDIVRAFCPDARGVRLVVQRPR
SGPAERPMRLVDDRGLYVGTVPAGARYRLKIGWADGWEEIDDPYSFGLLLGDLDLHLFTQ
GLHRDLDRVMGAQAMTVDGVAGVRFAVWAPNAFRVSVIGDFNVWDGRRHPMRLRHAAGIW
ELFIPGIGPGERYKYEILDAERRLLPPKADPMALAAEQPPATASVVADPTPFEWTDAAWM
ENRQDRQGITAPLSIYEVHAASWRRPEGDPQGIMHWDRLERELIPYVVEMGFSHIELMPI
MEHPFDGSWGYQTLGLYAPSARFGSPRQFASFVNACHNAGLGVILDWVPAHFPSDAHGLA
LFDGSFLYEHQDRREGFHPDWNTLIYNFGRHEIRGFLIGSALMWLRRYHIDGLRVDAVAS
MLYRDYSRREGEWISNIHGGRENLEAIAFLRGLNTTIAELCPSAVMMAEESTAWPGVSQP
VVDGGLGFSYKWNMGWMHDTLAYMSRDPIWRRYHHSEIMFGLHYAFSERFVLPLSHDEVV
HGKGSLIARMPGDEWRKHAGLRAYFAFMWAHPGKKLLFMGGELAQPHEWHADGELAWYGL
AQPLVQGVQTLVRDVNRLYAAYPALHRADCTPDGFAWVIGDDSDNAVFAWLRMAPGVAPV
LVVCNMTPIPRPLYRVGVPCGGYWRELLNTDAGEYAGSGMGNGGGAQALPEPSHGYDQSC
VLVLPPLAVLYLSPESFGGGWA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgcccggaacgactgtacctacacccttccatcggggaccgaagacctgctt
gccggaacctgtcccgatccgttctccatcctggggcggcacccgcatggccgcgtggac
atcgtccgcgccttctgccccgacgcgcggggggtgcggctggtggtgcagcgcccgcgc
tcgggcccggccgaacgccccatgcgcctggtcgacgaccggggcctgtatgtcggcacc
gtccccgccggggcgcgctaccggctgaagatcggctgggccgacgggtgggaggagatc
gacgatccgtattccttcgggctgctgctgggcgacctggacctgcatctgttcacccag
ggcctgcatcgcgacctggatcgcgtgatgggcgcgcaggccatgaccgtggacggcgtg
gccggggtgcgtttcgcggtctgggcgcccaatgccttccgcgtctcggtgatcggcgac
ttcaatgtatgggacggccgccgccatccgatgcgcctgcgccatgccgccgggatctgg
gaactgttcattcccggcatcggccccggcgagcgctacaagtatgaaatcctggatgcc
gaacgccgcctgctgccgcccaaggccgacccgatggcgctggcggcggaacagccgccc
gccacggcctcggtcgtggccgatcccacgccgttcgaatggaccgacgccgcctggatg
gaaaaccgccaggaccgccagggcatcaccgccccgctgtcgatctacgaagtccatgcc
gcgtcatggcgccgtccggagggcgacccgcagggcatcatgcactgggaccggctggag
cgggaactgatcccctacgtggtggaaatggggttcagccatatcgagctgatgcccatc
atggaacatcccttcgacgggtcctgggggtaccagacgctggggctgtacgcgccctcg
gcgcgcttcggctcgccccggcagttcgcctcgttcgtgaatgcctgccacaatgcgggg
ctgggggtgatcctggactgggtgccggcgcattttccctccgacgcgcatggcctggcc
ctgttcgatgggtctttcctgtacgagcaccaggatcggcgtgaaggattccatcccgac
tggaacacgctgatctacaatttcggccggcacgaaatccgcggtttcctgatcggcagc
gccctgatgtggctgcggcgctatcatatcgacgggctgcgggtcgatgccgtggcctcg
atgctctatcgcgactacagccggcgcgagggggaatggatctcgaacatccatggcggg
cgcgaaaacctggaagcgatcgcgttccttcgcggcctgaacaccacgatcgcggaactc
tgcccctcggcggtcatgatggcggaggaatcgacggcctggcccggcgtcagccagccg
gtcgtcgatggcgggctgggcttttcctacaaatggaacatgggctggatgcacgacacg
ctggcctacatgtcgcgcgacccgatctggcggcgctatcaccattccgaaatcatgttc
ggcctgcactacgctttttcggaacgattcgtgctgcccctgtcgcatgacgaggtcgtg
cacggcaagggctcgctgatcgcgcgcatgcccggtgacgaatggcgcaagcatgccggt
ctgcgcgcctatttcgccttcatgtgggcccatccgggcaagaagctgctgttcatgggc
ggcgaactggcccagccgcacgaatggcatgccgatggcgaactggcctggtacggtctg
gcgcagccgctggtccagggggtgcagaccctggtccgcgacgtcaaccggctgtatgcc
gcctatcccgccctgcatcgtgccgactgcacgcccgacggcttcgcctgggtgatcggc
gacgacagcgacaacgccgtcttcgcctggctgcgcatggcaccgggcgtcgccccggtg
ctggtggtgtgcaacatgacgccgataccccgcccgctatatcgcgtcggcgtgccgtgc
ggcggatactggcgcgaactgctgaataccgatgccggagagtacgcgggttcgggcatg
ggcaacggcggcggcgcgcaggccctgcccgagccgtcgcatggctacgaccagtcctgc
gtgctggtcctgccgcccctggcggtgctgtacctctcgcccgaatcctttggcgggggc
tgggcatga

DBGET integrated database retrieval system