KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_1822Help
Entry
Gdia_1822         CDS       T00798                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Gdia_1822
Enzymes [BR:gdj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Gdia_1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2021998..2024388)
Genome map
AA seq 796 aa AA seqDB search
MNEMSPLSTAPLTATPLSAAELGLFNRWWHAANYLSVGQIYLLANPLLREPLKLEHTKPR
LLGHWGTTPGLNFLYLHLNRIIRARDANILFIAGPGHGAPGVVANTYLEGTYSEYFPEVS
QDENGLGRLLKQFSFPGGIPSHAAATTPGSIHEGGELGYSLSHAYGAVFDNPDLIVACVI
GDGEAETGPLATSWHSNKFLDPQTDGAVLPILHLNGYKIANPTILARIPQPELEALLRGY
GYDPIFVEGHDPDPMHQKMATAMDLAFDRIAAIQKAAREGGQTERPTWPMIVMRSPKGWT
GPKEIDGLRTEGYWRSHQVPFSDLTKPGHLQALETWLRSYKPEDLFDESGRLFADIAALA
PSGARRMSDNPHANGGQLRHPLKLPDIANYAVPVTTPGSVTGEGTRVLGTWLRDVMKENL
PSRNFRVLAPDENNSNRLNAVLDVTNRAWNAETVDYDDHLARDGHVMEILSEHTCQGWLE
GYLLTGRHGFMSCYEAFIHIVDSMVNQHAKWLKTSAEVPWRRSISSLNYLLTSHVWRQDH
NGFSHQDPGFIDHVINKKADIVRVYLPPDANTLLCTAAHCLHSWDRINVIVAGKQPEPQW
LSMEDAIRHCSAGIGIWEWASNDKGSEPDVVMACAGDVPTIETLAAVKLLREHAPDLKIR
VINVVDLMTLESASQHPHGLTDSAFDALFTLDKPVIFAFHGYPQLIHKLIYRRANARNFH
VHGFREEGSTTTPFDMVVRNHLDRFHIVSNVIDRVPGLATRAAYAKQAIRDKLVDHTRYI
AEYGRDMPEIEDWRWS
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagatgtcccccctgtccaccgcgcccctgacggccacgccgctgtcggcggcg
gaactcggcctgttcaaccggtggtggcatgcggcgaactatctgtcggtgggccagatc
tacctgctggccaacccgctgctgcgtgaaccgctgaagctggaacataccaagccgcgc
ctgctgggccactggggcacgaccccggggctgaacttcctctacctgcacctcaaccgc
atcatccgcgcgcgggacgccaacatcctcttcatcgccggtcccgggcatggcgcgccg
ggcgtcgtggccaatacgtacctcgaaggcacgtacagcgaatatttccccgaggtgtcg
caggacgaaaacgggctgggccgactgctgaagcagttttccttccccggcggcattccc
agccacgcggcggcgacgaccccgggctcgattcatgagggtggcgagctgggctactcg
ctctcgcacgcctatggcgcggtgttcgacaatcccgacctgatcgtggcctgcgtcatc
ggcgatggcgaggccgagaccggtccgctggccacgtcgtggcacagcaacaagttcctc
gacccgcagaccgacggcgccgtgctgccgatcctgcacctgaacggctacaagatcgcg
aaccccaccatcctggcccgcattccgcagcccgaactggaagcgctgctgcggggctac
gggtacgatccgatcttcgtcgaaggccacgaccccgacccaatgcaccagaagatggcg
acggccatggacctggccttcgaccggatcgccgcgatccagaaggcggcgcgcgagggc
gggcagaccgaacgccccacctggccgatgatcgtcatgcgcagccccaagggctggacc
gggccgaaggaaatcgacggcctgcggaccgaaggctactggcggtcgcatcaggtgccg
ttctcggacctgaccaagcccgggcacctgcaggcgctggaaacctggctgcgcagctac
aagcccgaggacctgttcgacgaatccggccgcctgttcgccgacatcgcggccctggcc
ccgtccggcgcacggcgcatgagcgacaacccccatgccaatggcggacagttgcgccac
ccgctgaaactgccggacatcgcgaactacgccgtgccggtcaccacgccgggcagcgtg
acgggcgagggcacgcgcgtgctgggcacgtggctgcgcgacgtgatgaaggaaaacctg
ccctcgcgcaatttccgtgtcctggccccggacgaaaacaattccaaccgcctgaacgcg
gtgctggacgtcaccaaccgcgcgtggaacgcggaaacggtggattatgacgaccacttg
gcgcgcgacggccatgtgatggaaatcctcagcgagcacacctgccagggctggctggaa
ggctacctgctgaccggccgccatggcttcatgtcgtgctacgaggcgttcatccacatt
gtcgattcgatggtgaatcagcatgcgaaatggctgaagacctcggccgaagtgccgtgg
cggcggtcgatttcctcgctgaactacctgctgacgtcgcatgtctggcgccaggaccat
aacggcttcagccaccaggaccccggcttcatcgatcatgtgatcaacaagaaggccgat
atcgtccgcgtgtacctgccgcccgatgccaacaccctgctctgcaccgccgcgcactgc
ctgcatagctgggaccgcatcaacgtcatcgtggccggcaagcagccggaaccgcaatgg
ctgagcatggaagacgccatccgccattgcagcgccggcatcggtatctgggaatgggcc
agcaacgacaagggcagcgaaccagacgtggtgatggcctgcgccggcgacgtacccacc
atcgaaacgctggcggcggtcaagctgttgcgtgagcacgcgccggacctgaagatccgc
gtcatcaacgttgtggacctgatgacgctggaatcggccagccagcacccgcacggcctg
acggattccgccttcgacgcgctgttcacgctggacaagccggtcatcttcgccttccat
ggctatccgcagctgatccacaagctgatctaccgccgcgccaacgcccggaacttccac
gtccacggcttccgcgaggaaggatcgaccaccaccccgttcgacatggtggtgcgcaac
cacctcgaccggttccacatcgtctcgaacgtcatcgaccgcgtgcccggcctggccacc
cgcgccgcctacgccaaacaggccatccgcgacaagctggtggaccacacccgctacatc
gccgaatacggacgcgacatgccggaaatcgaagactggcgctggtcgtaa

DBGET integrated database retrieval system