KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_1830Help
Entry
Gdia_1830         CDS       T00798                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Brite
Enzymes [BR:gdj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Gdia_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2032976..2034067)
Genome map
AA seq 363 aa AA seqDB search
MVPHRFAANRPPHGGFPRDVRLLTYTGASDRIMTAPTLVTGATGFVGSAVARTLLQRGHS
LRLMARKGADLTNIRDLPAELVEGDLSAPATFADAVRGCRYVFHVAADYRLWVPDPAPMM
TANVEGTRRLMLAAQDAGVERIVYCSSVAALGLIGDGTVSDEDTPVHEHAVIGIYKRSKY
RAEQEVLRLVRERGLPAVIVNPSTPVGPRDIKPTPTGQMILDCAAGRMPAYVDTGVNIVH
VDDVAEGHVLALERGRAGEKYILGGQNFLLRDLFAMTADIAGVRPPRVSLPQSVIWPVAV
VSEWLSRGFGIAPRVTREMLAMSHKKMFFSSAKAERELGYAPRPARDAVADAVAWFRQNG
MLG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgcatcgtttcgccgccaaccggccgccccatgggggtttcccccgggacgtc
cgcctgctgacatataccggagcatccgatcggatcatgactgcccccacgcttgttacc
ggcgcgaccggttttgtcggttcggccgttgcccgtacgcttctccagcgggggcattcg
ctgcgcctgatggcgcgcaagggggcggacctgaccaatatccgcgacctgccggcggaa
ctggtcgaaggcgacctgtccgcgcccgccaccttcgccgacgcggtgcgggggtgtcgc
tacgtcttccatgtcgccgccgactatcggctgtgggtgcccgaccccgcgcccatgatg
accgcgaatgtcgagggaacgcgccgcctgatgctggcggcgcaggacgcgggggtggaa
cggatcgtctattgctcgtcggtcgcggcgctggggctgatcggcgacggcaccgtgtcg
gacgaggacacgccggttcacgagcacgcggtgatcgggatctacaagcggtccaaatac
cgggcggagcaggaggtcctgcgcctggtccgcgaacgcggcctgccggcggtgatcgtc
aacccgtccacccccgtgggcccgcgcgacatcaagccgacgccgacgggccagatgatc
ctggattgcgcggcggggcgcatgccggcctatgtcgataccggggtgaacatcgtccat
gtcgacgacgtggccgagggccacgtcctggcgctggaacgcggccgggcgggtgagaaa
tacatcctgggcggccagaatttcctgctgcgcgacctgttcgccatgacggcggacatc
gcgggcgtgcggccgccgcgcgtcagcctgccgcaatcggtgatctggccggtggcggtg
gtgtcggaatggctgtcgcgcggcttcggcatcgccccgcgcgtcacgcgcgagatgctg
gccatgtcgcacaagaagatgttcttttcctcggccaaggccgaacgggagctgggctat
gccccgcgcccggcgcgcgacgcggtggcggatgccgtggcctggttccgccagaacggc
atgctgggctag

DBGET integrated database retrieval system