KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_1830Help
Entry
Gdia_1830         CDS       T00798                                 

Definition
(GenBank) hopanoid-associated sugar epimerase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Brite
Enzymes [BR:gdj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Gdia_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase NAD_binding_10 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NmrA Polysacc_synt_2 RmlD_sub_bind KR adh_short
Motif
Other DBs
NCBI-ProteinID: ACI51590
JGI: Gdia1830
UniProt: A9HGZ6
Position
complement(2032976..2034067)
Genome map
AA seq 363 aa AA seqDB search
MVPHRFAANRPPHGGFPRDVRLLTYTGASDRIMTAPTLVTGATGFVGSAVARTLLQRGHS
LRLMARKGADLTNIRDLPAELVEGDLSAPATFADAVRGCRYVFHVAADYRLWVPDPAPMM
TANVEGTRRLMLAAQDAGVERIVYCSSVAALGLIGDGTVSDEDTPVHEHAVIGIYKRSKY
RAEQEVLRLVRERGLPAVIVNPSTPVGPRDIKPTPTGQMILDCAAGRMPAYVDTGVNIVH
VDDVAEGHVLALERGRAGEKYILGGQNFLLRDLFAMTADIAGVRPPRVSLPQSVIWPVAV
VSEWLSRGFGIAPRVTREMLAMSHKKMFFSSAKAERELGYAPRPARDAVADAVAWFRQNG
MLG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgcatcgtttcgccgccaaccggccgccccatgggggtttcccccgggacgtc
cgcctgctgacatataccggagcatccgatcggatcatgactgcccccacgcttgttacc
ggcgcgaccggttttgtcggttcggccgttgcccgtacgcttctccagcgggggcattcg
ctgcgcctgatggcgcgcaagggggcggacctgaccaatatccgcgacctgccggcggaa
ctggtcgaaggcgacctgtccgcgcccgccaccttcgccgacgcggtgcgggggtgtcgc
tacgtcttccatgtcgccgccgactatcggctgtgggtgcccgaccccgcgcccatgatg
accgcgaatgtcgagggaacgcgccgcctgatgctggcggcgcaggacgcgggggtggaa
cggatcgtctattgctcgtcggtcgcggcgctggggctgatcggcgacggcaccgtgtcg
gacgaggacacgccggttcacgagcacgcggtgatcgggatctacaagcggtccaaatac
cgggcggagcaggaggtcctgcgcctggtccgcgaacgcggcctgccggcggtgatcgtc
aacccgtccacccccgtgggcccgcgcgacatcaagccgacgccgacgggccagatgatc
ctggattgcgcggcggggcgcatgccggcctatgtcgataccggggtgaacatcgtccat
gtcgacgacgtggccgagggccacgtcctggcgctggaacgcggccgggcgggtgagaaa
tacatcctgggcggccagaatttcctgctgcgcgacctgttcgccatgacggcggacatc
gcgggcgtgcggccgccgcgcgtcagcctgccgcaatcggtgatctggccggtggcggtg
gtgtcggaatggctgtcgcgcggcttcggcatcgccccgcgcgtcacgcgcgagatgctg
gccatgtcgcacaagaagatgttcttttcctcggccaaggccgaacgggagctgggctat
gccccgcgcccggcgcgcgacgcggtggcggatgccgtggcctggttccgccagaacggc
atgctgggctag

DBGET integrated database retrieval system