KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_1845Help
Entry
Gdia_1845         CDS       T00798                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00230  Purine metabolism
gdj01100  Metabolic pathways
Module
gdj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Gdia_1845
Enzymes [BR:gdj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Gdia_1845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_29 AAA_23 RsgA_GTPase AAA_22 APS_kinase ABC_tran MMR_HSR1 AAA_33
Motif
Other DBs
NCBI-ProteinID: ACI51605
JGI: Gdia1845
UniProt: A9HDA8
Position
2054928..2055620
Genome map
AA seq 230 aa AA seqDB search
MTHSRERQPGERPPAHHQGPAGGPVVARRGVCLVISAPSGAGKSTIANALRAAEPRLLHS
VSVTTRQPRPGETDGVHYHFRSMEQFQQMAEAGELLEWATVFGRGYGTPRGPVESALAEG
RDMVFDIDWQGHRQIRAALPDDVISLFVLPPSLAELERRLCNRASDHPEEIERRMKAARD
EIAHWQEFDHVIINADLDRAIGEARSVLTAARLQTRRQAGLAAFVAGFGA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacagccgcgaacgacagccgggcgaacgcccccccgcccatcaccagggtccg
gcgggcggcccggtcgtggcgcggcgcggggtgtgcctggtgatctcggccccgtcgggg
gccggaaaatcgaccattgccaatgcgttgcgcgcggccgagccccggctgctgcattcg
gtttccgtcaccacccgccagccccggcccggcgagaccgacggcgtccactatcatttc
cgcagcatggaacagttccagcagatggccgaggccggcgaattgctggaatgggcgacg
gtgttcggccggggctacggcacgccgcgcggcccggtcgaatcggccctggccgagggg
cgggacatggtgttcgacatcgactggcagggccaccggcagatccgcgccgccctgccc
gacgacgtcatcagcctgttcgtgctgccgccgtcactggcggaactggagcgccggctg
tgcaatcgcgcgtccgaccaccccgaggagatcgagcggcggatgaaggcggcgcgcgac
gaaatcgcgcactggcaggaatttgatcacgtcatcatcaatgccgacctggaccgggcg
atcggcgaggcccggtcggtcctgacggcagcgcggctgcagacccggcggcaggcaggg
ctggcggccttcgtcgccggattcggcgcgtag

DBGET integrated database retrieval system