KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_1966Help
Entry
Gdia_1966         CDS       T00798                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00260  Glycine, serine and threonine metabolism
gdj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gdj01100  Metabolic pathways
gdj01110  Biosynthesis of secondary metabolites
gdj01130  Biosynthesis of antibiotics
gdj01230  Biosynthesis of amino acids
Module
gdj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gdia_1966
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gdia_1966
Enzymes [BR:gdj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gdia_1966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACI51726
JGI: Gdia1966
UniProt: A9HE87
Position
complement(2180580..2181815)
Genome map
AA seq 411 aa AA seqDB search
MSATDRFLPPGANSLRAGPDLRGRFGIFGGQFVAETLMPLVLELDAAYAQAKADPAFRRE
LDYYLKDYVGRPSPLWFARRLTRELGGAKIYMKREELNHTGSHKLNNVMGQILLARRMGR
TRIVAETGAGQHGVATATVCALFGLKCVIYMGATDVERQKPNVFRMRLLGAEVVPVTSGA
GTLKDAMNEAMRDWVTNVRDTYFLVGTVAGPHPYPQMVRDFQSVIGEETKVQMQEAEGRL
PDIIVAAIGGGSNAMGIFHPFLDDPSVRLIGVEAAGRGLDSGETAASILRGRPGVLHGNR
TYLLQDADGQIDEAHSISAGLDYPGIGPEHSWLNDIGRAEYVGATDDEALAAFQLCTRTE
GIIPALECAHGLAHVAKIAPTLDPETLVVLNVSGRGDKDIFTVAAHLGVTL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcaacagacagattcctgccgcccggggccaacagcctgcgcgccggcccggac
ctgcgcggccggttcggcatcttcggcggccagttcgtggccgagaccctgatgccgctg
gtgctggagctggatgccgcctacgcgcaggccaaggccgatccggccttccgccgcgag
ctggattactacctgaaggattacgtgggccgccccagcccgctgtggttcgcccgccgc
ctgacccgggaactgggcggggcgaagatctacatgaagcgcgaggagctgaaccatacc
ggttcgcacaagctcaacaacgtcatggggcagatcctgctggcgcgccgcatgggccgc
acccgcatcgtcgccgaaaccggggcgggccagcacggcgtcgccaccgccacggtctgc
gcgctgttcggcctgaaatgcgtgatctacatgggcgccaccgacgtcgagcggcagaag
cccaacgtgttccgcatgcgcctgctgggcgccgaggtcgtgcccgtgacgtcgggtgcc
ggcacgctgaaggacgcgatgaacgaggcgatgcgcgactgggtgaccaatgtccgcgac
acctatttcctggtcggcacggtggccggcccgcacccctatccgcagatggtccgcgat
ttccagtcggtgatcggcgaggagacgaaggtgcagatgcaggaggccgagggacggctg
ccggatatcatcgtcgcggccatcggcggcggttcgaacgccatgggcatcttccacccg
ttcctggacgatccttcggtgcgcctgatcggcgtcgaggccgccgggcgggggctggac
agcggcgagacggcggcctcgatcctgcgcgggcggccgggcgtgctgcacggcaaccgc
acctatctgctgcaggacgcggacggccagatcgacgaggcccattcgatcagcgccggg
ctggattatcccggcatcggcccggaacattcctggctgaacgatatcggccgggccgaa
tatgtgggcgccacggatgacgaggccctggcggccttccagctctgcacccggaccgaa
ggcatcatcccggccctggaatgcgcgcacgggctggcgcatgtggcgaagatcgcgccc
accctggacccggagaccctggtcgtcctgaacgtctccggccggggtgacaaggacatc
ttcaccgtcgcagcacatctgggagtgacattgtga

DBGET integrated database retrieval system