KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_2108Help
Entry
Gdia_2108         CDS       T00798                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gdia_2108
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gdia_2108
   00650 Butanoate metabolism
    Gdia_2108
  Energy metabolism
   00190 Oxidative phosphorylation
    Gdia_2108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2335917..2336339)
Genome map
AA seq 140 aa AA seqDB search
MNASHTPRMDVMRSQLSRARGLGSAKTGVDHWWMERMSAVALVPLSGWFVLQVLRLAGSS
QEDVVEWGGKPVNSSMLLALMVLTFYHMQLGLQVIIDDYVHGKAHLPVSLLMKGAAFLIG
LFAVIAVLKLALAPSRKAIA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgtcccatacgccgcgcatggatgtcatgcgctcgcaattgtcccgggcacgg
ggactgggctcggccaagaccggggtggaccactggtggatggagcggatgtccgccgtc
gccctggtgccgctgtcgggctggttcgtgctgcaggtcctgcgcctggcgggctccagc
caggaagatgtcgtggaatggggcggcaagcccgtcaattcctcgatgctgctggccctg
atggtcctgaccttctaccacatgcagctgggcctgcaggtcatcatcgatgactatgtg
catggcaaggcgcatctgccggtcagcctgctgatgaagggcgccgccttcctgatcggg
ctgttcgccgtgatcgccgtcctgaagctggcactggccccgtcgcgcaaggcaatcgcc
tga

DBGET integrated database retrieval system