KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_2119Help
Entry
Gdia_2119         CDS       T00798                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gdj01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gdj00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:gdj00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2348127..2349401
Genome map
AA seq 424 aa AA seqDB search
MSAEIKVPTLGESVTTATIAKWLKKPGEAVTADEPVVELETDKVSVEVAAPEAGVMGPQL
VAEGDEVEVGTVLASVEAGSGAAAKPAAAAPAPKKAAEAPKAPAGVQAQPTTSGPVARPA
TPPSDVAAQGAAHAPMPSAQKMMTEKGVTTAEIGIGTGKDGRVTKGDVLAFLSQPPVAKA
AAAPAAPRTDDPREERVKMTRLRRTIARRLKDAQNTAALLTTFNEVDMSAAKAMRAEYRD
LFEKKNGGVKLGFMSIFAKAAIAALKEFPAINAEIDGDDVIYREFINLGIAVGGPNGLVV
PVIRDADKLNFAGIESAIAGFGKRARDGSLKLDELSGGTFSITNGGIYGSLMSTPIVNAP
QSGILGMHAIQDRPVAVNGQVVIRPMMYIALTYDHRIVDGKEAVSFLVRVKQNVEDPRRL
LLEV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgagatcaaggtcccgactctgggcgagagcgtgacgaccgccacgattgcg
aaatggctgaagaagcccggtgaagcggtgacggccgacgaaccggtggtggaactggag
accgacaaggtcagcgtcgaggtcgcggcgcccgaagccggcgtgatgggcccgcaactg
gtggccgagggtgacgaggtcgaggtcggcaccgtcctggcctcggtcgaggccggcagc
ggcgccgccgccaagcccgcggccgctgccccggcgccgaagaaggccgccgaggccccg
aaggccccggccggcgtgcaggcccagccgaccaccagcggccccgtcgcccgtcccgcg
accccgccgtccgacgtcgcggcccagggggcggcccacgcgccgatgccgtcggcccag
aagatgatgaccgaaaagggcgtgacgaccgccgaaatcggaatcggcaccggcaaggac
gggcgcgtgaccaagggtgacgtcctggccttcctgtcgcagccgccggtggccaaggcc
gccgcggccccggccgccccgcgcaccgacgacccgcgcgaggaacgggtgaagatgacc
cgcctgcgccggaccatcgcccgccgcctgaaggacgcgcagaacaccgccgccctgctg
accaccttcaacgaggtggacatgtcggcggccaaggcgatgcgcgccgaatatcgcgat
ctgttcgagaagaagaacggcggcgtgaagctgggcttcatgtcgatcttcgccaaggcg
gccatcgcggcgctgaaggaattcccggcgatcaacgcggaaatcgacggcgacgacgtg
atctatcgcgaattcatcaatctcggcatcgcggtcggcggcccgaacgggctggtcgtg
ccggtcatccgcgacgcggacaagctgaacttcgcggggatcgaaagcgcgatcgcgggc
ttcggcaagcgtgcgcgtgacgggtcgctgaaactggacgaactgtcgggcggcacgttc
tcgatcaccaacggtggcatctacggttcgctgatgtccacgccgatcgtcaatgccccg
cagtcgggcatcctgggcatgcatgccatccaggaccgtccggtcgccgtgaacggccag
gtcgtgatccggccgatgatgtacatcgccctgacctacgatcaccgcatcgtcgacggc
aaggaggctgtcagcttcctggtgcgcgtcaagcagaacgtggaagacccgcgtcgtctg
ctgctcgaggtctga

DBGET integrated database retrieval system