KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_2119Help
Entry
Gdia_2119         CDS       T00798                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gdia_2119
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gdia_2119
  Amino acid metabolism
   00310 Lysine degradation
    Gdia_2119
Enzymes [BR:gdj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Gdia_2119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2348127..2349401
Genome map
AA seq 424 aa AA seqDB search
MSAEIKVPTLGESVTTATIAKWLKKPGEAVTADEPVVELETDKVSVEVAAPEAGVMGPQL
VAEGDEVEVGTVLASVEAGSGAAAKPAAAAPAPKKAAEAPKAPAGVQAQPTTSGPVARPA
TPPSDVAAQGAAHAPMPSAQKMMTEKGVTTAEIGIGTGKDGRVTKGDVLAFLSQPPVAKA
AAAPAAPRTDDPREERVKMTRLRRTIARRLKDAQNTAALLTTFNEVDMSAAKAMRAEYRD
LFEKKNGGVKLGFMSIFAKAAIAALKEFPAINAEIDGDDVIYREFINLGIAVGGPNGLVV
PVIRDADKLNFAGIESAIAGFGKRARDGSLKLDELSGGTFSITNGGIYGSLMSTPIVNAP
QSGILGMHAIQDRPVAVNGQVVIRPMMYIALTYDHRIVDGKEAVSFLVRVKQNVEDPRRL
LLEV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgagatcaaggtcccgactctgggcgagagcgtgacgaccgccacgattgcg
aaatggctgaagaagcccggtgaagcggtgacggccgacgaaccggtggtggaactggag
accgacaaggtcagcgtcgaggtcgcggcgcccgaagccggcgtgatgggcccgcaactg
gtggccgagggtgacgaggtcgaggtcggcaccgtcctggcctcggtcgaggccggcagc
ggcgccgccgccaagcccgcggccgctgccccggcgccgaagaaggccgccgaggccccg
aaggccccggccggcgtgcaggcccagccgaccaccagcggccccgtcgcccgtcccgcg
accccgccgtccgacgtcgcggcccagggggcggcccacgcgccgatgccgtcggcccag
aagatgatgaccgaaaagggcgtgacgaccgccgaaatcggaatcggcaccggcaaggac
gggcgcgtgaccaagggtgacgtcctggccttcctgtcgcagccgccggtggccaaggcc
gccgcggccccggccgccccgcgcaccgacgacccgcgcgaggaacgggtgaagatgacc
cgcctgcgccggaccatcgcccgccgcctgaaggacgcgcagaacaccgccgccctgctg
accaccttcaacgaggtggacatgtcggcggccaaggcgatgcgcgccgaatatcgcgat
ctgttcgagaagaagaacggcggcgtgaagctgggcttcatgtcgatcttcgccaaggcg
gccatcgcggcgctgaaggaattcccggcgatcaacgcggaaatcgacggcgacgacgtg
atctatcgcgaattcatcaatctcggcatcgcggtcggcggcccgaacgggctggtcgtg
ccggtcatccgcgacgcggacaagctgaacttcgcggggatcgaaagcgcgatcgcgggc
ttcggcaagcgtgcgcgtgacgggtcgctgaaactggacgaactgtcgggcggcacgttc
tcgatcaccaacggtggcatctacggttcgctgatgtccacgccgatcgtcaatgccccg
cagtcgggcatcctgggcatgcatgccatccaggaccgtccggtcgccgtgaacggccag
gtcgtgatccggccgatgatgtacatcgccctgacctacgatcaccgcatcgtcgacggc
aaggaggctgtcagcttcctggtgcgcgtcaagcagaacgtggaagacccgcgtcgtctg
ctgctcgaggtctga

DBGET integrated database retrieval system