KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_2331Help
Entry
Gdia_2331         CDS       T00798                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gdj00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2585220..2586719
Genome map
AA seq 499 aa AA seqDB search
MTSYVGAIDQGTTSSRFIIFDRQGRIASVAQKEHRQIYPRPGWVEHDPVEIMNNTNEMIG
AALARANLAAEDLAAVGITNQRETTVLWDRETGRPLHNALVWQDTRVDQLVTTFAADGGQ
DRFRQVTGLPLASYFAGLKLRWLLDNVDGARAKAEAGQALFGTIDSWVIWNLTGGPNGGI
HVTDVTNASRTQLMNLETCDWDRGMLDVFAIPAACLPKIVPSSFVYGEIATPTLKGTKIA
GILGDQQAALVGQTCFSPGEAKNTYGTGSFLLMNTGVKPVQSKAGLLTTLAYQFGEERPC
YALEGAIAITGALVQWLRDNLKLFDIATQIEPLARSVEDNGGIYIVPAFSGLYAPYWKEN
ARGVIAGLTRYVTRAHFARAALESTAYQVRDVVEAMESDSGIRLTSLKTDGGMVANELLM
QFQADILNVPVVRPKVVETTALGAAYAAGLAVGYWSNTDDLRANWEIDKTWTPSMPEDRR
AHYTKSWKKAVQRSFDWVD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaccagctatgtcggcgcgatcgaccagggaacgaccagttcgcgcttcatcatcttc
gaccgccaaggccggatcgcctcggtcgcgcagaaggaacatcgacagatctatccccgc
ccgggctgggtggaacatgaccctgtcgaaatcatgaacaacaccaacgaaatgatcggg
gcggcgctggcccgcgccaacctggcggcggaggacctggccgccgtcggcatcaccaac
cagcgggaaacgaccgtcctgtgggaccgggaaaccggcaggccgctgcacaacgccctg
gtgtggcaggatacgcgggtcgatcaactggtcacgacattcgccgccgacggggggcag
gaccgtttccgccaggtcaccggcctgccgctggccagttacttcgcggggctgaagctc
cgctggctgctggacaacgtggatggcgcgcgcgcgaaggcggaagcggggcaggccctg
ttcggcaccatcgacagctgggtcatctggaacctgaccggcgggccgaacggcggcatc
catgtgacggacgtcaccaacgcctcgcgcacccagttgatgaacctggaaacctgcgac
tgggatcgcggcatgctggacgtcttcgccattcccgccgcatgcctgcccaaaatcgtg
ccctcatccttcgtgtatggtgaaatcgccacgccgacgctgaagggtacgaagatcgcc
ggcatcctgggcgaccagcaggccgccctggtcggccagacctgcttttcaccgggcgag
gccaagaacacctacggcacgggctcgttcctgctgatgaacacgggcgtcaagccggtg
cagtccaaggcgggcctgctgacgacgctggcctaccagttcggcgaggaacgcccctgc
tacgcgctggagggcgccatcgccatcaccggggcgctggtgcaatggctgcgcgacaat
ctgaaactgttcgatatcgcgacccagatcgaaccgctggcccgcagcgtggaggataac
ggcggtatctatatcgtgccggccttctccggcctgtacgcgccgtactggaaggaaaac
gcccgtggcgtgatcgccgggctgacgcgctacgtcacccgggcgcatttcgcccgcgcg
gcgctggaatccaccgcctatcaggtgcgcgacgtggtggaggcgatggaaagcgacagc
ggcatcaggctgaccagcctgaagaccgacggcggcatggtggccaacgaactgctgatg
cagttccaggccgacatcctgaacgttcccgtcgtccgacccaaggtcgtcgaaaccacg
gccctcggcgccgcctacgcggcggggctggccgtggggtactggagcaacacggacgac
ctgcgcgccaactgggaaatcgacaagacctggacaccgtccatgccggaagaccgccgc
gcccattacacgaaatcctggaagaaggccgtgcagcggtccttcgactgggtggattga

DBGET integrated database retrieval system