KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_2745Help
Entry
Gdia_2745         CDS       T00798                                 

Definition
fumarate lyase
Orthology
K01857  
3-carboxy-cis,cis-muconate cycloisomerase [EC:5.5.1.2]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
Benzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Gdia_2745
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gdia_2745
Enzymes [BR:gdj01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.2  3-carboxy-cis,cis-muconate cycloisomerase
     Gdia_2745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3018961..3020382
Genome map
AA seq 473 aa AA seqDB search
MATSVIDSPVFRDLFTEPRVRKIWSDSGRTEQYLAVEAALSEVQGRLGIIPADAAKKIAS
VCLLEKIDMVRLADETAEIGYPVLPLVHQIQSLAGDAGDWCHWGATTQDITDTATVLQIK
ASLDVVADLLERCIAAASGLARAHRDLPMVGRSNLQQAVPITFGFKMARLAACLLRHRER
LAELRPRIEVLEFGGACGTLASLGDRGLDVQKVLADTLGLARPPITWHTDRDSIAETACF
LGLVTGTLSKFATDLKTMMMTEVNEAAEPFVLNRGSSSTMPQKRNPISCCYITACAASVR
QSTAALLGSMDADHERATGPWEIEWIELPRIFSLASGALSQAAFVIEGLEVNGDRMAANL
GITKGLIMSEAVMMALAPKIGRGQAHDMLYKVCRAALEQNRSLAEMLKADDAVTEQLSHR
QIDHLTDPARYLGCAGEMIDAVLAHSTTSDHDPITTLAENLDEGFPSRAIADS
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaccagcgtcatcgacagccccgttttccgggacctcttcaccgaaccgcgtgtt
cgcaagatctggtcggactccggacggaccgagcagtacctcgccgttgaagcagcactc
tcggaggttcaagggcggctcggcattatccccgcagacgctgcgaagaaaattgcgtcc
gtttgcttgctcgagaagatcgacatggtacggctcgcggatgaaacggcagagatcggc
tatccggtcctcccgctcgtccaccagatccagtcgctcgccggcgatgcgggcgactgg
tgccattggggtgccactacgcaagacatcaccgataccgctaccgtcctgcagataaag
gcgtcgctcgacgtggtggccgatctgctcgaacgctgcatcgccgcagcctccggcctc
gcccgtgcacatcgcgatttgccgatggtggggcgctcgaacctacagcaggcggtgcca
atcaccttcggctttaagatggcaagactggccgcttgcctgttacgtcatcgcgagcgg
ttggcggagctacgtccgcgtattgaggttctggagttcggcggcgcctgcgggacgctc
gcctctctcggcgatcgcggtctcgatgtccagaaagtcctcgccgacacgctgggcctc
gcccgaccgcccatcacctggcacacggatcgcgactcgattgctgaaacggcatgtttc
cttggccttgttaccgggacgctgtcaaagttcgctaccgatctcaagaccatgatgatg
acggaagtgaacgaggcagccgagccgttcgttcttaatcgcggctcctcctcgaccatg
ccgcagaagcgcaatccgatctcgtgctgctacatcactgcctgtgcggcgagtgtgcgc
cagtcgaccgcagcccttctcggcagcatggatgctgaccatgagcgcgcgacggggccg
tgggagatcgagtggatcgaactgccgcgtatattttcgctcgctagcggggcactgtcg
caagccgctttcgtaatcgaggggcttgaggtgaacggggatcgaatggccgcgaacctc
ggtatcaccaaagggctcatcatgtcggaagctgtcatgatggctctggcaccgaagatc
ggtcggggccaggctcacgacatgctctacaaagtctgccgcgcggcgctcgaacaaaac
aggtcgctagccgagatgctaaaggcggacgacgccgtcacggagcagctttcgcatcgg
cagatcgaccacctgaccgatccggcgcgctatctcggctgtgccggagagatgattgac
gcggtgctcgctcattcgacaacatcggatcatgaccctattactactctcgcagaaaat
ttggacgaaggattcccttcgagagcgatcgctgattcatag

DBGET integrated database retrieval system