KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_2911Help
Entry
Gdia_2911         CDS       T00798                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gdj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3189738..3190331
Genome map
AA seq 197 aa AA seqDB search
MGGTDIERLIALLARLPGLGPRSARRAALALLRQPQARMLPLAQAMEQAARSVRTCSSCG
NLDTHDPCTICADPGRDRGLVCVVETVGDLWALERAGVHRGVYQVLGGTLSALAGMGPDD
LNVASLLARIEQGGVREIILALGATVDGATTAHWLQDRLAAFDVPVSRVGQGVPMGGALD
VLDDGTLAAALMARRPA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcacggacatcgaacggctgatcgcgctgctggcgcgcctgccgggcctgggt
ccgcgttcggcccgccgtgcggcgctggcgctgctgcgccagccccaggcgcggatgctg
ccgctggcccaggcgatggagcaggcggcgcggtcggtgcgcacctgttcgtcctgcggc
aacctggatacgcatgatccctgcaccatctgcgccgatcccggccgcgatcgcggcctg
gtctgcgtggtcgagacggtgggggatctgtgggcgctggaacgcgccggcgtgcatcgc
ggcgtctatcaggtgctgggcggcacgctctcggccctggcgggcatggggccggatgat
ctgaacgtggcgtcgctgctggcgcggatcgaacagggcggggtgcgcgaaatcatcctg
gcgctgggcgccacggtcgatggcgccaccacggcgcactggctgcaggaccggctggcc
gccttcgacgtgccggtcagccgggtcgggcagggggtgccgatgggcggcgcgctggac
gtgctggacgacggcacgctggccgcagccctcatggcgagacgacctgcttaa

DBGET integrated database retrieval system