KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_3053Help
Entry
Gdia_3053         CDS       T00798                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Gdia_3053
   00240 Pyrimidine metabolism
    Gdia_3053
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Gdia_3053
   03430 Mismatch repair
    Gdia_3053
   03440 Homologous recombination
    Gdia_3053
Enzymes [BR:gdj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Gdia_3053
DNA replication proteins [BR:gdj03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Gdia_3053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3343236..3343682
Genome map
AA seq 148 aa AA seqDB search
MAEIGFYHLTRTPVEQALPALLGRTLDAGRRAVLRCGDAARVKAMDEALWQSADPVWLPH
GSAAMGHGALQPIWLTDGPDVPNGATYLFAIDGVVCPDAGTFERVFDLFDGSDADAVAAA
RRRWVTCREAGHTLVYWQQQAKGWARKA
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatcggcttctatcatctgacgcggaccccggtggaacaggcgctgccggcc
ctgctggggcgcacgctggatgccgggcggcgtgccgtcctgcggtgcggcgacgcggcg
cgggtgaaggcgatggacgaggcgctgtggcaatccgccgatccggtctggctgccgcat
ggcagcgccgccatgggccatggtgcgctgcagccgatctggctgaccgacggcccggac
gtgcccaatggcgcgacctatctttttgcgatcgacggcgttgtctgtccggatgccggg
acgttcgaacgggtgttcgacctgttcgacggcagcgacgcggatgcggtggcagccgcg
cgccggcgatgggtgacatgccgcgaggccgggcatacgctcgtctactggcagcagcag
gcaaaaggctgggcccgcaaggcttga

DBGET integrated database retrieval system