KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_3186Help
Entry
Gdia_3186         CDS       T00798                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gdj01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gdj00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3489808..3490956)
Genome map
AA seq 382 aa AA seqDB search
MTAPESTGLPDLGAARRVVVKIGSALVVDSGTEPGQAAPRAAWLDSVARDIAELRRAGTD
IIVVSSGAIALARHGLGLTRRTLRLEEKQAAASVGQIRLAQAWTDALSAHGLVAAQLLLT
PDDTEDRRRYLNARATLDTLLGLGCVPVINENDAIATTEIRFGDNDRLAARVAEMTGADQ
LILLSDIDGLYTADPRIDPTARHLPVIPALTAEIEAMGGAPPPGYSSGGMRTKLMAARIA
TQAGCAMAITIGKDVHPLARLRQGARCSWFLPMPDGRSARKRWIAGGLAPAGRLAIDDGA
RRALATGSSLLPAGVRTVEGDFERGDLLLVTDLDGNEIARGLSAYSAADARQIAGHRSDD
IEGLLGWRGRDEMIHRDDLVLG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcccccgaatccaccggcctgcccgacctgggcgccgcccgccgcgtcgtcgtg
aagatcggcagcgcgctggtcgtggattcggggaccgagcccggccaggccgcgccgcgc
gccgcctggctggacagcgtcgcccgcgacattgcggagcttcggcgcgccggcaccgac
atcatcgtcgtgtcctcgggcgccatcgcgctggcgcggcacgggctgggactgacgcgc
cgcaccctgcggctggaggaaaagcaggccgcggcctcggtcgggcagatccgcctggcc
caggcctggaccgacgcgctgtcggcgcacggactggtcgccgcgcaattgctgctgacc
cccgacgacaccgaggaccggcgccgctacctgaacgcccgcgccacgctggacaccctg
ctgggcctgggctgcgtgcccgtgatcaacgagaacgacgcgatcgccaccaccgaaatc
cgcttcggcgacaatgaccgcctggccgcccgggtggcggaaatgaccggcgccgaccag
ttgatcctgctgtcggacatcgacgggctctataccgccgacccgcgcatcgaccccacg
gcgcggcacctgccggtcatccccgccctgacggcggagatcgaggccatgggtggcgcc
ccgccaccgggctattcctcgggcgggatgcgcaccaagctgatggcggcgcgcatcgcc
acccaggccggctgcgcgatggccatcacgatcggcaaggacgtccacccgctggcccgg
ctgcgccagggggcgcgctgctcgtggttcctgccgatgccggacgggcgttcggcgcgc
aagcgctggatcgcgggcggcctggcccccgcggggcggctggccatcgatgacggcgcc
cgccgcgcgctggccaccgggtcgtcgctgctgcccgccggggtacgcacggtggagggc
gacttcgaacgcggcgacctgctgctggtcaccgacctggacgggaacgagatcgcgcgc
ggcctgtcggcctacagcgccgccgacgcccgccagatcgccggccaccgctcggacgat
atcgaaggacttctgggctggcgcggccgggacgagatgattcaccgcgacgacctggta
ctgggctga

DBGET integrated database retrieval system