KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_3196Help
Entry
Gdia_3196         CDS       T00798                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Gdia_3196
Enzymes [BR:gdj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Gdia_3196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3501476..3502426)
Genome map
AA seq 316 aa AA seqDB search
MPRPKSKNHPLVVFGSINIDMVARLHHFPAPGETLHAQGTDLGLGGKGANQAVAVARLGA
EVLLMGRTGDDMFADYAATSLRRRGVGPDGLFRSPGDTTGLAMICTDSAGENTIVVAGGA
NLAMDGDDVARLVPLLTPGAIVLMQCEIPMDTILAAARRVDAAGATLILDPAPVPDAGLP
DELFRLATLMTPNETETERLTGLRPHDPDSARQAAGRLHQKGLRRAIIKLGARGVLYSDE
SGHGFIPPFHVTAIDSVAAGDCFNGGLAVALSQGLDLARATRFAAACGALATTRKGAADA
APTREEVEGLLSAQPR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgccccgacccaaaagtaaaaatcaccctctggttgtattcggtagcatcaatatcgat
atggtcgcccggttgcatcactttcccgcgccaggcgaaactttacacgcacagggcacc
gacctggggcttgggggcaagggcgccaaccaggcggtggcggtcgcgcgcctgggggcg
gaggtcctgctgatgggccggaccggcgacgacatgttcgccgactacgccgctacctcc
ctgcggcggcgcggcgtcgggccggacggcctgttccgctcgcccggcgacacgaccggc
ctggccatgatctgcaccgacagcgcgggggaaaacaccatcgtcgtcgccgggggcgcc
aacctggcgatggatggcgacgatgtggcacgcctggtgccgctgctgacgccgggcgcg
atcgtgctgatgcagtgcgagatcccgatggacaccatcctggccgccgcccgccgggtc
gacgccgccggcgcgaccctgatcctggaccccgccccggtccccgatgccggcctgccc
gacgaattgttccgtctggccacgctgatgacccccaacgaaaccgagaccgaacgcctg
accggactgcgcccccacgaccccgacagcgcgcgccaggccgcgggccggctgcaccaa
aaggggctgcgccgggccatcatcaagctgggcgcgcggggcgtgctgtattccgacgag
tcgggccacggattcattccccctttccacgtcaccgccatcgacagcgtggcggcgggc
gattgtttcaatggcgggctggccgtagcgttgtcgcagggcctggacctggcccgggcc
acgcgcttcgccgccgcctgcggcgcgctggccaccacgcgcaagggcgcggcggacgcc
gccccgacccgcgaggaagtggagggcctgctttcggcacagccgcgataa

DBGET integrated database retrieval system