KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_3371Help
Entry
Gdia_3371         CDS       T00798                                 

Definition
glutamyl-tRNA(Gln) amidotransferase subunit C
Orthology
K02435  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Gdia_3371
Enzymes [BR:gdj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Gdia_3371
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Gdia_3371
Mitochondrial biogenesis [BR:gdj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Gdia_3371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3693124..3693411
Genome map
AA seq 95 aa AA seqDB search
MSLDPATVRRIARLARIGINESDLHALQGELNGILGWIEQLNEVDIDGVEPMVGTGHAAL
RMREDVVTDGAARDAVLSNAPDAAGPFYTVPKVVE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttgatcccgcgaccgtccgacgtatcgccaggctggcgcggataggtatcaac
gaatccgacctgcacgccctccagggggagttgaacggcattctcggctggatcgagcaa
ttgaacgaggtggatatcgacggcgtcgaaccgatggtcggcaccggacatgccgccctg
cgcatgcgcgaggacgtggtgaccgacggggccgcgcgcgatgccgtcctgtcgaacgcg
cccgacgcggcggggccgttctataccgtgccgaaggtggttgaataa

DBGET integrated database retrieval system