KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_3371Help
Entry
Gdia_3371         CDS       T00798                                 

Definition
glutamyl-tRNA(Gln) amidotransferase subunit C
Orthology
K02435  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:gdj00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3693124..3693411
Genome map
AA seq 95 aa AA seqDB search
MSLDPATVRRIARLARIGINESDLHALQGELNGILGWIEQLNEVDIDGVEPMVGTGHAAL
RMREDVVTDGAARDAVLSNAPDAAGPFYTVPKVVE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttgatcccgcgaccgtccgacgtatcgccaggctggcgcggataggtatcaac
gaatccgacctgcacgccctccagggggagttgaacggcattctcggctggatcgagcaa
ttgaacgaggtggatatcgacggcgtcgaaccgatggtcggcaccggacatgccgccctg
cgcatgcgcgaggacgtggtgaccgacggggccgcgcgcgatgccgtcctgtcgaacgcg
cccgacgcggcggggccgttctataccgtgccgaaggtggttgaataa

DBGET integrated database retrieval system