KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_3398Help
Entry
Gdia_3398         CDS       T00798                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gdia_3398
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gdia_3398
   00640 Propanoate metabolism
    Gdia_3398
   00660 C5-Branched dibasic acid metabolism
    Gdia_3398
Enzymes [BR:gdj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Gdia_3398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3721495..3722709)
Genome map
AA seq 404 aa AA seqDB search
MNIHEYQAKALLKGFGMPVPDGRVVRSPDEALLAARAMGAPLVVVKAQIHAGGRGAGHFA
HDPGGKGGVRLARTPEDAEQAAIAMLDQTLVTRQTGSAGRVVRRLYIEAGCDIGRELYLS
LLVDRGTGRIVIVASQDGGMAIEDVAAATPERILKEPIDPATGLSDYQARTLAARLDLHG
RSIRAFTTVLRAAYDAFVALDAAIVEINPLVVTRSGDLLALDAKMSFDDNALFRHPELEE
LRDENEEDPREREAARHGLAYVGLDGTIGCMVNGAGLAMATMDIIKMEGEEPANFLDVGG
GATRERVAAAFRILLSDRKVRGILVNIFGGIMRCDIIADAIVAASRETGLHVPLVVRLAG
TNVEQGHQILSASGLRIIPADDLADAATKIVAAVRETAFAGGAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacatgaatatcaggcaaaggccctgttgaagggcttcggcatgccggttccc
gatgggcgcgtcgtccgttccccggacgaagccctgctggccgcccgcgcgatgggtgcc
ccgctggtggtggtcaaggcgcagatccatgccggcggccgcggcgcgggtcatttcgcc
catgatcccggcggcaagggcggcgtacgcctggcccgcacgcccgaggatgccgagcag
gccgccatcgcgatgctggaccagaccctggtcacgcgccagaccggctctgccggccgc
gtggtccgccgcctgtatatcgaggccggatgcgatatcgggcgcgagctgtacctgtcg
ctgctggtggatcgcggcactgggcgcatcgtcatcgtggcgtcgcaggacggcggcatg
gcgatcgaggacgtcgccgccgccacgcccgagcgtatcctgaaggaaccgatcgacccg
gccaccggcctgtccgactaccaggcgcgcacgctggcggcgcggctggacctgcatgga
cgctcgatccgcgccttcaccaccgtgctgcgcgcggcctatgacgcgttcgtggcgctg
gacgccgcgatcgtcgagatcaatccgctggtcgtcacccggtcgggcgaccttctggcg
ctggacgccaagatgagcttcgacgacaacgcgctgttccgccatccggaactggaagaa
ctgcgcgacgagaacgaggaagacccccgcgagcgcgaggccgcgcgccacggcctggcc
tatgtcgggctggacgggaccatcggctgcatggtcaacggcgccgggctggcgatggcg
accatggacatcatcaagatggagggcgaggaaccggccaacttcctggacgtgggcggc
ggcgccacgcgcgaacgggtggcggcggcgttccgcatcctgctgtccgaccgcaaggtg
cgcggcatcctggtgaacatcttcggcggcatcatgcgctgcgacatcatcgcggacgcc
atcgtcgccgcgtcgcgcgaaacggggctgcacgtgccgctggtggtgcggctggccggc
accaacgtcgaacaggggcaccagatcctgtcggcatcggggctgaggatcatcccggcc
gacgacctggccgacgcggccaccaagatcgtcgccgccgtgcgcgaaaccgctttcgcc
gggggggccgcctga

DBGET integrated database retrieval system