KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_3470Help
Entry
Gdia_3470         CDS       T00798                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Gdia_3470
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Gdia_3470
Enzymes [BR:gdj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Gdia_3470
Two-component system [BR:gdj02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Gdia_3470
Bacterial motility proteins [BR:gdj02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Gdia_3470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3802629..3803666
Genome map
AA seq 345 aa AA seqDB search
MEKPVRVLVVDDSRTIRALIKRSFGQNPDIVVCGEAANPIEARDLIIQDQPDVITLDVEM
PGMNGLQFLEKIMRLRPIPVVMVSSLTARGADTAITALQMGAFDCFPKPSSVVGADAFAG
LARLVIQAARSHPVARLPRRDPASPPRQHADWGHSIGLIAIGASTGGVEAIEEVLSGFPA
QSPPIVICQHMPALFTASFANRLDQKIAALSIGEARDGEVLAPGVVRIAPGGDRHTVVER
RDGRYVTRLVKSPPVSGHCPSVDVLFGSVARQAGNDALGIILTGMGQDGAEGLLAMRHAG
AQTIAQDKASAVVYGMPRIAAEIGAASRIVPLCQISAAAMTVHTR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggagaagccggtcagggttctcgttgttgacgactcgcggacaataagggcgcttatc
aagaggtccttcggccagaacccggatatcgtcgtttgtggcgaagcggcgaacccgatc
gaggcgcgggacctgatcatccaggatcagccggacgtcatcacgctcgatgtcgagatg
cccggcatgaacggtctccagttcctggagaagatcatgcgactgcgcccgattccggtc
gtgatggtatccagcctgaccgcgcggggtgccgacacggcgatcacggccctgcagatg
ggcgcgttcgattgtttcccgaaaccgtcctcggtcgtcggcgcggatgctttcgccggc
ctggcgcggcttgtcatccaggccgcgcgttcgcatcccgttgccaggcttccgcgtcgc
gacccggcgtccccgccgcgccagcatgcggactgggggcattcgatcgggctgatcgcg
atcggggcctcgaccggtggagtcgaggcgatcgaggaagtgctgtcaggctttcccgcc
cagagcccacccatcgtcatctgccagcatatgcccgcgcttttcacggccagcttcgcc
aacaggctggaccagaagatcgcggccctgtccataggtgaggcaagggatggcgaggtg
ctggcgcccggtgtcgtcaggatcgccccgggtggggacaggcacaccgtggtggaacgg
cgcgacggccggtacgtgacgcgcctggtgaaatcaccgccggtcagtggccactgcccc
tcggtggatgtcctgttcggctccgttgccaggcaggccggcaacgatgcccttggcatt
atcctgaccggcatgggccaggatggagccgagggcctcctcgccatgcggcatgccggg
gctcagacgattgcgcaggacaaggcgtctgcggtcgtttatggaatgcctcggattgca
gccgagatcggggcggcttcccggattgtccctctttgccagatcagcgccgccgccatg
accgttcatacgcgttga

DBGET integrated database retrieval system