KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_3501Help
Entry
Gdia_3501         CDS       T00798                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00010  Glycolysis / Gluconeogenesis
gdj00020  Citrate cycle (TCA cycle)
gdj00620  Pyruvate metabolism
gdj01100  Metabolic pathways
gdj01110  Biosynthesis of secondary metabolites
gdj01120  Microbial metabolism in diverse environments
gdj01130  Biosynthesis of antibiotics
gdj01200  Carbon metabolism
Module
gdj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gdia_3501
   00020 Citrate cycle (TCA cycle)
    Gdia_3501
   00620 Pyruvate metabolism
    Gdia_3501
Enzymes [BR:gdj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Gdia_3501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Biotin_lipoyl Hydrolase_4 Biotin_lipoyl_2 Ser_hydrolase Esterase DUF1057 Thioesterase PGAP1
Motif
Other DBs
NCBI-ProteinID: ACI53225
JGI: Gdia3501
UniProt: B5ZD00
Position
complement(3833399..3834523)
Genome map
AA seq 374 aa AA seqDB search
MTDSITPITMPKFGLAMTEGKLAGWMVRPGASVKAGDDLADIETSKITNAYESPAGGVLR
RQVAAEGDTLPVGALIGVLADASVPDAEIDAFITRFNAEFSSGAGGEAEEAAPEPKLVDV
QGNSLRVLDLGHGDATPIVLVHGFGGDIGNWLFNHAALAAGRRVIAFDLPGHGGSTKDVG
AGSLDFFAGIVVGLLDTLGIPQAHLVGHSLGGGVALTVARTAPARVASLALIAPAGMGPE
INMDFITGFITADRQKTIQPVLAMLVHDKTLVGRKMADDVLRYKRLDGAVAALTQIAATC
FPDGKQADDLRPVLEQGDVRALILWGEDDEILPAKQSRGLPGRVTIDLLPGVGHMPQMER
AADINKAIAAFVAK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgactgattccattacgcccatcacgatgcccaagttcggcctggcgatgaccgagggc
aagctggccggctggatggtccgccccggtgccagcgtgaaggccggcgacgacctggcg
gatatcgagaccagcaagatcaccaacgcctatgaaagcccggccggcggcgtgctgcgc
cgccaggtggcggcggaaggcgacacgttgccggtgggcgcgctgatcggcgtgctggcc
gatgccagcgtgccggatgccgagatcgacgccttcatcacgcgcttcaacgccgaattc
tcctccggcgccggcggcgaggccgaggaagcggccccggaaccgaaactggtggacgtg
cagggcaacagcctgcgggtcctggacctgggccatggggacgccacgcccatcgtgctg
gtccacggcttcggcggtgatatcgggaactggctgttcaaccacgcggccctggccgcc
ggccggcgcgtcatcgccttcgacctgcccgggcatggcggatcgacgaaggatgtgggc
gcggggtcgctggatttcttcgccggcatcgtcgtcgggctgctggacacgctgggcatc
ccgcaggcccacctggtggggcattcgctgggcggcggcgttgccttgacggtggcccgg
accgcacccgcgcgcgtcgcctccctggcgctgatcgcgccggccggcatgggccccgag
atcaacatggacttcatcaccgggttcatcacggccgaccggcagaagacgatccagccg
gtcctggccatgctggtccatgacaagacgctggtggggcgcaagatggcggacgacgtc
ctgcgctacaagcgcctggacggcgccgtcgccgccctgacgcagattgccgccacctgc
ttccccgacggcaagcaggccgacgacctgcggcccgtgctggaacagggcgacgtgagg
gcgctgatcctgtggggcgaggacgacgagatcctgcccgcgaagcagtcccggggcctg
ccgggccgcgtcacgatcgacctcctgcccggggtcggccatatgccgcagatggagcgg
gcggccgacatcaacaaggcgatcgcggcgttcgtcgcgaaatag

DBGET integrated database retrieval system