KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_3540Help
Entry
Gdia_3540         CDS       T00798                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gdia_3540
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gdia_3540
   00052 Galactose metabolism
    Gdia_3540
   00500 Starch and sucrose metabolism
    Gdia_3540
   00520 Amino sugar and nucleotide sugar metabolism
    Gdia_3540
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Gdia_3540
   00524 Butirosin and neomycin biosynthesis
    Gdia_3540
Enzymes [BR:gdj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Gdia_3540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3873019..3873987
Genome map
AA seq 322 aa AA seqDB search
MREIVAVDIGGTHARFAIAGVEGGRVTHLGEATTLKCAEHASLQLAWESFARQVGRTLPR
AAGIAVACPVQGDILKLTNNPWIIQPAQLAAKLDVDQHVLVNDFGAVGHAVAQVDAAHLQ
HLCGPDRPLPASGVTTIVGPGTGLGTAYVVRRDGRYLVCETEGGHVDFSPLDMLEDKILQ
RLRRRYRRVSTERVVSGPGLVNLYEAIAEIEGLPVRTRDDKELWTLALDGADHMAAAALE
RFCLALGAVAGDLALSQGGNSVVIAGGLGLRLAQHLPRSGFAERFVAKGRFESLMADMPV
KLITHPQPGLFGAAAAFAERFA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagagagatcgtagccgtcgatatcggcgggactcatgcgcgtttcgccattgccggt
gtcgagggcggccgtgtcacccacctgggggaagccaccaccctgaaatgcgcggagcat
gccagcctgcaactggcgtgggagtccttcgcccgtcaggtcggccgcaccctgccgcgt
gcggcgggcatcgccgtcgcctgcccggtgcagggcgatatcctgaagctgacgaacaat
ccctggatcatccagccggcccaactggccgcgaagctggatgtggaccagcatgtgctg
gtcaatgatttcggcgcggtgggccacgccgtggcccaggtggacgcggcccatctgcag
cacctgtgcggcccggaccggccgctgcccgccagcggggtgacgaccatcgtcgggccg
ggaacggggctgggcaccgcctatgtcgtgcggcgggacggccgctatctggtgtgcgag
accgaaggcggccatgtcgatttctcgcccctcgacatgctggaggacaagatcctgcag
cgcctgcgccggcgatatcgccgcgtgtcgaccgagcgcgtcgtgtcgggcccggggctg
gtcaatctgtacgaggcgatcgccgaaatcgagggcctgccggtccgcacgcgcgacgac
aaggaattatggaccctggcgctggacggagccgaccatatggccgcggcggcgctggag
cgattctgcctggcgctgggggccgtcgccggtgacctggcgctgtcgcagggtggcaac
agcgtggtgatcgcgggcggcctgggcctgcggctggcccagcatctgccccggtccgga
ttcgccgagcgattcgtcgccaaggggcgattcgaatcgctgatggccgacatgccggtc
aagctgatcacccacccgcagcccggcctgttcggcgcggcggcggccttcgccgagcga
ttcgcctga

DBGET integrated database retrieval system