KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_3540Help
Entry
Gdia_3540         CDS       T00798                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00010  Glycolysis / Gluconeogenesis
gdj00052  Galactose metabolism
gdj00500  Starch and sucrose metabolism
gdj00520  Amino sugar and nucleotide sugar metabolism
gdj00521  Streptomycin biosynthesis
gdj01100  Metabolic pathways
gdj01110  Biosynthesis of secondary metabolites
gdj01120  Microbial metabolism in diverse environments
gdj01130  Biosynthesis of antibiotics
gdj01200  Carbon metabolism
Module
gdj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gdia_3540
   00052 Galactose metabolism
    Gdia_3540
   00500 Starch and sucrose metabolism
    Gdia_3540
   00520 Amino sugar and nucleotide sugar metabolism
    Gdia_3540
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Gdia_3540
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Gdia_3540
Enzymes [BR:gdj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Gdia_3540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK Hairpins
Motif
Other DBs
NCBI-ProteinID: ACI53263
JGI: Gdia3540
UniProt: A9HI04
Position
3873019..3873987
Genome map
AA seq 322 aa AA seqDB search
MREIVAVDIGGTHARFAIAGVEGGRVTHLGEATTLKCAEHASLQLAWESFARQVGRTLPR
AAGIAVACPVQGDILKLTNNPWIIQPAQLAAKLDVDQHVLVNDFGAVGHAVAQVDAAHLQ
HLCGPDRPLPASGVTTIVGPGTGLGTAYVVRRDGRYLVCETEGGHVDFSPLDMLEDKILQ
RLRRRYRRVSTERVVSGPGLVNLYEAIAEIEGLPVRTRDDKELWTLALDGADHMAAAALE
RFCLALGAVAGDLALSQGGNSVVIAGGLGLRLAQHLPRSGFAERFVAKGRFESLMADMPV
KLITHPQPGLFGAAAAFAERFA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagagagatcgtagccgtcgatatcggcgggactcatgcgcgtttcgccattgccggt
gtcgagggcggccgtgtcacccacctgggggaagccaccaccctgaaatgcgcggagcat
gccagcctgcaactggcgtgggagtccttcgcccgtcaggtcggccgcaccctgccgcgt
gcggcgggcatcgccgtcgcctgcccggtgcagggcgatatcctgaagctgacgaacaat
ccctggatcatccagccggcccaactggccgcgaagctggatgtggaccagcatgtgctg
gtcaatgatttcggcgcggtgggccacgccgtggcccaggtggacgcggcccatctgcag
cacctgtgcggcccggaccggccgctgcccgccagcggggtgacgaccatcgtcgggccg
ggaacggggctgggcaccgcctatgtcgtgcggcgggacggccgctatctggtgtgcgag
accgaaggcggccatgtcgatttctcgcccctcgacatgctggaggacaagatcctgcag
cgcctgcgccggcgatatcgccgcgtgtcgaccgagcgcgtcgtgtcgggcccggggctg
gtcaatctgtacgaggcgatcgccgaaatcgagggcctgccggtccgcacgcgcgacgac
aaggaattatggaccctggcgctggacggagccgaccatatggccgcggcggcgctggag
cgattctgcctggcgctgggggccgtcgccggtgacctggcgctgtcgcagggtggcaac
agcgtggtgatcgcgggcggcctgggcctgcggctggcccagcatctgccccggtccgga
ttcgccgagcgattcgtcgccaaggggcgattcgaatcgctgatggccgacatgccggtc
aagctgatcacccacccgcagcccggcctgttcggcgcggcggcggccttcgccgagcga
ttcgcctga

DBGET integrated database retrieval system