KEGG   Gluconacetobacter diazotrophicus PAl 5 (JGI): Gdia_3541Help
Entry
Gdia_3541         CDS       T00798                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gdj  Gluconacetobacter diazotrophicus PAl 5 (JGI)
Brite
Enzymes [BR:gdj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Gdia_3541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3874333..3875013
Genome map
AA seq 226 aa AA seqDB search
MNQSALGEAVLDYDAARQRMVDAQIRPVAINDSRIIAAMRALPREDCVPEALRPFAYADQ
SLEIGRGRVLTEPRIAGRMVQIAAPQAAQRALVVGAGTGYLAALLARLELQVTALESDAA
LSAIGKAFCAVEAPGVTWVDGPLQAGDPAHAPFDLIVIDGAVREVPHALPGQLAEHGRIV
CVIWPQGGVASACIAEPTAQGLAVRRVFDVALPLLPELEPAPAFAF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtccgcgcttggagaagccgtcctcgattacgatgccgcgcggcaaaggatg
gtggatgcgcagatccgcccggtggcgatcaacgattcgcgaatcatcgcggcgatgcgt
gccctgccgcgcgaggactgcgtccccgaggcgctgcgccccttcgcctatgccgaccag
agcctggagatcggccgcggccgcgtgctgacggaaccgcgcattgccgggcggatggtg
cagatcgcggccccgcaggccgcgcagcgcgccctggtggtgggggccgggacgggctac
ctggccgcgctgctggcccggctggaactgcaggtcacggccctggaatccgatgccgcg
ctcagcgcgatcggcaaggccttctgcgcggtcgaggcaccgggcgtcacctgggtggac
ggcccgctgcaggcgggcgaccccgcgcatgcgccgttcgacctgatcgtgatcgacggg
gcggtgcgtgaggtcccgcatgccctgccgggacaactggccgagcacgggcgcatcgtc
tgcgtcatctggccccaggggggcgtcgcctccgcctgcatcgccgagcccaccgcgcag
gggctggcggtccgccgggtcttcgacgtcgccctgccgctgctgccggaactggagccc
gcgcctgcctttgcgttctga

DBGET integrated database retrieval system