KEGG   Geobacter sp. M18: GM18_0171Help
Entry
GM18_0171         CDS       T01421                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
geb  Geobacter sp. M18
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:geb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
200828..201421
Genome map
AA seq 197 aa AA seqDB search
MLHFSRSLTRLVGELKKLPGVGEKSALRLAFHLLKYPGNIEALSESLVQVKEKVRFCSLC
FAITEDDPCWICSGERDAAALCVVEEPQDLLALERSRAFRGRYHVLQGALSPLNGVTPRD
LRIAELMQRLEGGGVREVLIATNFSVEGEATALYLTRMIKPLGIKVTRLAHGIPIGSDLE
YVDAATVQRAVEGRSEL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgctacatttttcgcgctcgctgaccaggctggtgggagagttgaaaaaattgcctggc
gtcggtgaaaaaagtgccttgcggcttgcctttcatctgcttaaatatcccggtaatatc
gaggcgttatcggaaagcctcgtgcaggtgaaggaaaaggtccgtttttgctctctctgt
ttcgccatcaccgaggacgatccctgctggatctgctcgggggagcgggacgccgccgcc
ctctgcgtggtcgaggagccgcaagacctgctggcactggaaagaagccgcgccttccgc
ggccgctaccatgtgctgcagggggcgctttccccgctaaacggcgttacaccccgtgac
ctgaggatcgccgagctgatgcagcggctggaggggggcggggtgcgcgaggtgctgatc
gccaccaacttcagcgttgaaggggaggcgacggcgctgtacctgaccaggatgatcaag
ccgctggggatcaaggtgacgcgtctggctcacggcatcccgatcggcagcgacctggaa
tacgtggacgcagcgaccgtgcagcgggcagtggaggggcgttcggagctttga

DBGET integrated database retrieval system