KEGG   Geobacter sp. M18: GM18_0714Help
Entry
GM18_0714         CDS       T01421                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
geb  Geobacter sp. M18
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:geb00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    GM18_0714
Enzymes [BR:geb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     GM18_0714
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     GM18_0714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
874105..874890
Genome map
AA seq 261 aa AA seqDB search
MPELPDLTVYAENLGKALTGKKVDRVEYHQRGKLNVSAAELSRALAGAEVTGVQRGGKQV
AFHFGNGALLRVHLMLTGGFVLTSPSALDRLQHPVLTVAFSDGSALALTDEKGWASVALN
PGEEKDAPDALALSAEQLQQLCQRKPRTLIKPLLLDQALIGGIGNAYADEILWAARISPK
SPAGKLPPEAVKALADAIPAVLKDAITELRKRHPDMVSGEYREFLKVHRPELKVSPTGAK
IIKENVQSKRTYYTDEQRLYQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgccagagctcccggacctgactgtgtacgcagaaaatctgggcaaggcgttgaccggc
aagaaggtcgacagggtggagtatcaccagaggggaaagctgaacgtttctgcggcagaa
ctctcccgggcgctcgccggcgccgaggtgaccggcgtgcagaggggtgggaaacaggtc
gcctttcacttcggcaacggggcgttgctgcgggtgcatctgatgctgaccggcggcttc
gtcttgaccagcccatcggctctcgaccggctgcagcacccggtgctgactgtcgccttc
agcgacgggagcgcgcttgcgttgaccgatgaaaaggggtgggcgagcgtagccctcaat
cccggcgaggaaaaggacgcgcccgacgccctggccctcagcgccgaacaactgcagcag
ctctgccagaggaagccccggacgctcatcaagccgctgctgctcgatcaggcactgata
ggcggcatcggcaacgcctacgccgatgaaatcctctgggccgcgcgcatctcccccaag
tcgccggcgggcaaacttccccccgaagcggtaaaggccctggccgacgccatccccgcg
gtgctcaaggacgccatcaccgagctgaggaagaggcacccggacatggtatcgggggaa
taccgcgaattcctgaaggtgcaccgaccggaactgaaggtgtcgcccaccggagcgaag
atcatcaaagagaacgtccagtccaagcgcacctactacaccgacgagcagcggctgtac
cagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system