KEGG   Geobacter sp. M18: GM18_0892Help
Entry
GM18_0892         CDS       T01421                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
geb  Geobacter sp. M18
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:geb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GM18_0892
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GM18_0892
Enzymes [BR:geb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GM18_0892
Two-component system [BR:geb02022]
 CheA family
  CheA-CheYBV
   GM18_0892
Bacterial motility proteins [BR:geb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GM18_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1069386..1070474)
Genome map
AA seq 362 aa AA seqDB search
MPIKVLVIDDSALIRSLLTEIINAAPDLQVVGTAPDPLVARQRIKELNPDVLTLDVEMPK
MDGLAFLEKLMRLRPMPVVMVSSLTEKSCAVTLKALELGAFDFVTKPKIDIRSGLMEYAQ
ELTEKIRLAQLSFRRKGAGRSPLPQLETKLSADAVLPNRHQHFSTTEKVVAVGSSTGGTE
ALKTFLAALPPDCPGILITQHMPETFTRTFAARLNGLCALAVKEAEHGERVLPGHAYIAP
GNRHMMLSRNGANYTIALDDGPPVSRHRPSVDVLFRSAANCAADNALGIILTGMGDDGAA
GMQEMHNAGARTLAQDEESCVVFGMPREAIARGGVDEVVPLSEMAGRLVSWLAAHGKRSF
RV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcccataaaggtgctggtaatagacgactccgccctgatccggtcgcttttgaccgag
atcatcaacgccgcccccgacctccaggtggtgggaacggcgccggacccgctggtggcc
cggcagcggatcaaggaactgaacccggacgtgctcaccctggacgtggagatgcccaag
atggacgggctggccttcctggaaaagctgatgaggctgcgccccatgccggtggtcatg
gtctcctcgctgacggagaagagctgcgccgtgacgctgaaggcgctggaacttggcgcc
ttcgacttcgtcaccaagccgaagatcgacatccgcagcggcctcatggagtacgcgcag
gaactcaccgagaagatccgcttggcccagctctccttcaggagaaagggcgccggcagg
agccccctgccgcagctggagacaaagctcagcgccgacgcggtgctccccaaccggcac
cagcacttctccaccacggaaaaggtggtcgccgtgggttcctccaccggcgggaccgag
gcgctcaagaccttcctcgcggcgctccccccggactgcccggggatactgatcacccag
cacatgcccgagaccttcacccgcaccttcgcggcccggctgaacggcctgtgcgccctg
gcggtcaaggaggcggagcacggtgagcgggtgctcccggggcacgcctacatcgcgccg
ggcaaccggcacatgatgctctccagaaacggggccaactacaccatcgccctggacgac
ggcccgccggtctcccggcaccgcccctcggtcgacgtgctgttccgctccgcagccaac
tgcgccgccgacaacgccctcggcatcatcctgaccgggatgggggacgacggcgccgcc
gggatgcaggagatgcacaacgccggagccaggacgcttgcccaggacgaggagagctgc
gtggtgttcggcatgccccgcgaggcgatcgcccggggtggagtggacgaggtggtcccc
ctgtccgagatggcaggacgcctggtgagctggctcgccgcgcacggcaagcgcagcttc
agggtatga

DBGET integrated database retrieval system