KEGG   Geobacter sp. M18: GM18_1085Help
Entry
GM18_1085         CDS       T01421                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
geb  Geobacter sp. M18
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:geb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GM18_1085
Enzymes [BR:geb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GM18_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1314451..1316640
Genome map
AA seq 729 aa AA seqDB search
MIDRPTTGTAVERISGSLERVTFHSEETGFCVLRVKVPGHRELVTVTGSAASVTPGEFLE
CTGSWHNDRTHGMQFKAEHLKVVPPTTLEGIEKYLGSGMVHGIGHHFAKVLVQTFREEVF
DVIENSPERLLELPGIGRKRMESVAGAWVEQKAIREIMVFLQSNGLGTARAVRIYKSYGN
EAIFKVTENPYRLALDIHGIGFKTADALAANLGIARDSMIRAQAGVRHVLQELSGSGHCA
AGRKELAESAAALLQIPLPVIEAAIEAEIAEENLVADRIGGQPCVFLAPLYRAEVGVASS
LSRLCLGAPPWSGIVAEEAIPWVESHNGITLSASQRDAIRLALKNKVVVVTGGPGVGKTT
LVNSILAIIRSRQLRVTLCAPTGRAAKRLTESTGIEARTIHRLLEFDPQTFGFKRDRENP
LATDLLVMDEASMVDVVLMNKLLPAIPDHAGLIVVGDVDQLPSVGPGCVLSDIIESGAVA
TVRLTEIFRQAAGSRIIVNAHRINRGELPLKDEGKELADFYFIPAATAEDIRGKLLQVIT
ERIPKRFGFDPVRDIQVLTPMNRGGLGTGSLNAELQGVLNGKAEPRVTRFGTGFAPGDKV
IQTVNNYEKEVFNGDIGRIIEVRQEEGTLTVDFDDRAVEYQFGELDEVALAYATSIHKSQ
GSEYTAVVIPLAMQHYTMLERNLIYTAVTRGKKLVVVIGEAKALAMAVHNQKSQRRMTNL
AGRIGTAPP
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgatagatagaccaaccacaggcacagcggtcgaaaggatttccggctccctggagagg
gtcaccttccatagcgaggagacggggttctgcgtgctgcgggtgaaggtcccggggcac
cgggagctggtgacggtgacagggagcgcggcatcggtcactccgggggagttcctggag
tgcaccggttcctggcacaacgaccgcacccacgggatgcagttcaaggccgagcacctg
aaggtggtcccgccgaccacgctggaggggatcgagaagtacctgggttccggcatggtg
cacggcatcgggcaccacttcgcgaaggtgctggtgcagaccttccgcgaggaggtcttc
gacgtcatcgagaacagccccgagcggctcctggaactgccggggattggccgcaagcgc
atggaaagcgtggcaggcgcctgggtggagcagaaggcgatccgggagatcatggttttc
ctgcagtcgaacgggctggggaccgcccgcgccgtgcggatttacaagagctacggcaac
gaggccatcttcaaggtgaccgagaacccgtaccggctggccctcgacatccacggcatc
ggcttcaagaccgccgacgccctcgccgcgaacctcggcatcgcgcgcgattccatgatc
cgggcgcaggcgggcgtcagacacgtgctgcaggagctttccggcagcggccactgtgcg
gcagggagaaaggaactggcggagagcgccgcagccctgcttcagatcccgctaccggtc
atcgaagcggccatcgaggcggaaatcgcggaggaaaacctggttgccgaccggatcggg
gggcaaccctgcgtattcctggcgccgctctaccgcgccgaggtgggcgtcgcctccagc
ctctcgcgcctttgcctgggggctcccccctggagcggcatcgtcgccgaagaggccatc
ccctgggtggagagccacaacggcatcaccctctccgcttcgcagcgcgacgccatccgg
ctcgccctgaagaacaaggtggtcgtggtgaccggcggccccggggtcggcaagaccacg
ctggtgaacagcatcctggccatcatccgctccaggcagttgagggtgaccctgtgcgcc
ccgaccggacgcgcggccaagcggctcaccgaatcgaccggcatcgaggccaggaccatc
catcgcctgctggagttcgatccgcagactttcggcttcaagcgcgaccgcgagaacccg
ctcgcgaccgacctcctggtcatggacgaggcctccatggtcgacgtggtgctgatgaac
aagctcctgccggccatcccggaccacgcggggctgatcgtcgtgggggacgtggatcag
ctcccctccgtcggccccggctgcgtcctttccgacatcatcgagtcgggcgccgtcgct
accgtgcgcctcaccgagatcttccggcaggcggcgggctcgaggatcatagtcaacgcc
caccgcatcaaccgcggcgagctccctctgaaagacgagggaaaggagctcgccgacttc
tacttcatcccagcagcgacagccgaggacatccgcggcaagctgctccaggtgatcacc
gagcgcatccccaagcgtttcggcttcgacccggtgcgcgacatccaggtgctgaccccc
atgaaccgcggcggactgggaaccggatcgctgaacgccgagctgcagggggtgctgaac
ggcaaggccgagccgagggtgacccgcttcgggaccggcttcgcgcccggcgacaaggtg
atccagacggtgaacaactacgagaaggaagtcttcaacggtgacatcggcaggatcatc
gaggtgcggcaggaagaggggaccctgacggttgatttcgacgacagggcggtagaatac
cagttcggcgagttggacgaggtggcgctcgcctacgccaccagcatccacaagagccag
gggtcggaatacacggcggtggtcatcccgctggccatgcagcactacaccatgctggag
cgcaacctgatttacaccgcggtgacccgcggcaagaagctcgtggtcgtgatcggcgag
gccaaggcccttgccatggcggtgcacaaccagaagtcccagcgcaggatgaccaacctg
gctggcaggatcggcaccgcgcccccctga

DBGET integrated database retrieval system