KEGG   Geobacter sp. M18: GM18_1183Help
Entry
GM18_1183         CDS       T01421                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
geb  Geobacter sp. M18
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GM18_1183
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM18_1183
   00052 Galactose metabolism
    GM18_1183
   00500 Starch and sucrose metabolism
    GM18_1183
   00520 Amino sugar and nucleotide sugar metabolism
    GM18_1183
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GM18_1183
   00524 Butirosin and neomycin biosynthesis
    GM18_1183
Enzymes [BR:geb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GM18_1183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1435276..1436184
Genome map
AA seq 302 aa AA seqDB search
MRQELCIGVDLGGSNLRLALVDRVGRVLARSAEPTLPAAGLDSLLARLLSALRRLMEEAL
KQGAPVAAVGLGLPGLVLSDGVVRSSVNVPPLEGVNLARELCRELGVPVLAINDANAGAL
GEKRYGAGRKYASFIMLTIGTGVGGGLILEGKLWTGADGTAGEFGHIPVEPEGRPCGCGS
RGCLEQYASATAITGESGDAAAVASRARQGDAEGLARFAEAGRYLGIAAAGVVNLLNLEG
IILGGGVAESFELLAPALRRELDSRTFPVPGARVRVEKGELGDDAGVLGAAAFAFDALSH
SL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcaggagctctgcatcggcgtggatctcggggggagcaacctgcgccttgccctg
gtggaccgggtggggcgggttctcgcgcgcagcgccgagcccacacttccggctgcgggg
ctcgactccttgctggcccgactgctgtcggcgctgcggcggctgatggaggaggccctg
aagcagggcgcgccggttgccgctgtcggcctggggctcccggggctggtcttgagcgac
ggggtggtccgctccagcgtcaacgtccctccgctggagggggtgaacctggcccgggag
ctttgccgggagctcggggtgccggtgctggccataaacgacgccaacgccggcgcgctg
ggtgaaaagcgctacggggccgggcggaagtacgcttcgtttatcatgctgaccatagga
accggtgtgggaggggggctgatcctggaaggaaagctctggaccggcgccgacggcacg
gccggggagttcggccacatcccggtcgagccggaagggcgtccctgcggctgcggcagc
cgggggtgtctggaacagtacgcctcggcaacggccatcaccggggaaagcggggatgcc
gccgccgtggccagccgcgcccggcagggggatgccgaggggctggcgcgctttgccgag
gccggccgctacctggggatcgctgcggcgggggtggtgaacctgctgaacctggagggg
atcatcctggggggaggtgtggcggagagtttcgagcttctggcgcccgccctgcgcagg
gagctcgactcgcggacctttcccgttcccggcgcacgggtccgggtcgaaaagggggag
ctgggagatgacgcgggggtgcttggggccgcggcgttcgccttcgacgccctgtcgcac
tctctttag

DBGET integrated database retrieval system