KEGG   Geobacter sp. M18: GM18_1184Help
Entry
GM18_1184         CDS       T01421                                 

Definition
disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
geb  Geobacter sp. M18
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1436286..1436996
Genome map
AA seq 236 aa AA seqDB search
MSFHRNILAALFSASLLLALAATSFAASAVKPDDSFRSAFPQVPFESMNPTEIPGLYEVI
SGQNIFYYYPDKELVLTGEIVGKDLKSRTAERKAAIAAKLVKDIPLDKAVKIGDGKKVVI
EFTDPDCPYCRKAAEYFTKRTDVTQYVFFAPLAHPGAIAKIEYILSAENKAQAYDAMMLG
QEIPASAKPASPAIKQLAQEHMALARKVGIQGTPTFFVNGQMVVGADVKKLDELLK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttcatagaaacatcctcgccgctcttttttccgcgtccctgctgctcgcgctg
gcggccacctcgttcgccgcgtccgcggtcaagccggacgactccttccgcagcgccttt
ccgcaggtccccttcgagagcatgaatcccaccgagattcccggtctctacgaggtgatc
tcggggcagaacatcttctactactacccggacaaggaactggtcctgaccggggagatc
gtggggaaggacctgaaaagccgcaccgccgagcgcaaggcggccatcgccgccaagctg
gtcaaggacatcccgctggacaaggcggtgaagatcggtgacggcaaaaaggtggtgatc
gagttcaccgacccggactgcccttactgcaggaaggccgccgagtacttcaccaagagg
accgacgtgacccagtacgtcttcttcgccccgctggcgcacccgggggcgatcgccaag
atcgagtacatcctgtcggcagagaacaaggcccaggcttacgacgccatgatgctgggg
caggagatccccgcttcggccaagcccgcgtcaccggcgatcaagcagctggcccaggag
cacatggcgctggcgaggaaggtggggatccaggggaccccgaccttctttgtcaacggc
cagatggtggtgggcgccgacgtcaagaagctggacgaactgctcaagtag

DBGET integrated database retrieval system