KEGG   Geobacter sp. M18: GM18_1285Help
Entry
GM18_1285         CDS       T01421                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
geb  Geobacter sp. M18
Pathway
geb00071  Fatty acid degradation
geb00280  Valine, leucine and isoleucine degradation
geb00310  Lysine degradation
geb00362  Benzoate degradation
geb00380  Tryptophan metabolism
geb00620  Pyruvate metabolism
geb00630  Glyoxylate and dicarboxylate metabolism
geb00640  Propanoate metabolism
geb00650  Butanoate metabolism
geb00900  Terpenoid backbone biosynthesis
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01120  Microbial metabolism in diverse environments
geb01130  Biosynthesis of antibiotics
geb01200  Carbon metabolism
geb01212  Fatty acid metabolism
geb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GM18_1285
   00630 Glyoxylate and dicarboxylate metabolism
    GM18_1285
   00640 Propanoate metabolism
    GM18_1285
   00650 Butanoate metabolism
    GM18_1285
  Lipid metabolism
   00071 Fatty acid degradation
    GM18_1285
   00072 Synthesis and degradation of ketone bodies
    GM18_1285
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GM18_1285
   00310 Lysine degradation
    GM18_1285
   00380 Tryptophan metabolism
    GM18_1285
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GM18_1285
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GM18_1285
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GM18_1285
Enzymes [BR:geb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GM18_1285
Exosome [BR:geb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GM18_1285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADW12754
JGI: GM18_1285
UniProt: E8WNV8
Position
1557142..1558317
Genome map
AA seq 391 aa AA seqDB search
MRDVFIVESLRTPFGSFGGSLSDVEAPVLGGTVIKALLEKTGLDPARVDEVIAGQVLAAG
VGQAPARQAMRFAGIPDAAHALTINKVCGSGLKSIMLGAGSIMLEDSEVVIAGGMENMSQ
APFVLKKARYGYRMGHGEITDLMIYDGLQDPYSGRHMGDISEEAVGRHALSRQAQDEFTI
RSYTLAQEAIRGGIFKDEIVPVIKKGRGGEVVVAEDEEPFKVDFGKLTALKPVFRKDGTI
TAANASSINDGAAFTLLAGADAVRRSNLTPKARIVAYATCSLHPEKYTEAPVGAIQGALA
KAGLKTCEIDLFEINEAFAAVAMIAIKELALDPGKVNVNGGACAIGHPIGASGGRLAATV
VRELNRRKARYGLATLCIGGGEAVAVIFERV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagacgtctttatcgtggaatcgctgagaaccccctttggctcctttggcggctcc
ttatccgacgtagaggcgcctgtcctggggggcaccgtgataaaggcgcttttggagaag
accggcctcgatccggcacgggttgacgaagtcatcgccggccaggtgcttgccgccggg
gtggggcaggcgcccgcccgccaggccatgcgcttcgcgggcatccccgatgccgcacac
gcgctgaccatcaacaaggtctgcggcagcggcctgaaatcgatcatgctcggagccggc
tccatcatgctggaggattccgaagtggtgatagccggcggcatggagaacatgtcccag
gcccccttcgtcctgaagaaggcccgctacggctaccggatgggacacggcgagatcacc
gatctcatgatctacgacggcctgcaggacccttactcggggcggcacatgggcgacatc
tccgaggaggctgtcggcaggcacgccctttcccgtcaggcgcaggacgaattcaccatc
cgctcctacaccctggcgcaggaagcgatccgcggcgggatcttcaaggacgagatcgtc
cccgtgatcaaaaaggggcgcggcggcgaggtggtggtggcagaggacgaggagccgttc
aaggtcgacttcgggaagctcaccgctctgaagccggttttcaggaaggacgggaccatc
accgccgccaacgcctcgagtatcaacgacggcgcggcgttcaccctgctcgccggcgcg
gacgccgtcaggcgcagcaacctcacgccgaaggcacgcatcgtcgcctatgccacctgc
agcctgcatcccgagaagtacaccgaggccccggtcggcgccatacagggggccttggcc
aaggcagggctgaagacctgcgaaatcgacctcttcgagatcaacgaggctttcgccgcg
gtggccatgatcgccatcaaggagcttgccctggatccggggaaggtgaacgtgaacggc
ggcgcctgcgccatcgggcatcccatcggcgccagcggcggcaggctggctgcgacggtg
gtccgcgagctcaacaggcgcaaagcgcgctacgggctggcgaccctttgcatcggcggc
ggggaagcggtagcggtcattttcgaaagggtctag

DBGET integrated database retrieval system