KEGG   Geobacter sp. M18: GM18_1370Help
Entry
GM18_1370         CDS       T01421                                 

Definition
disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
geb  Geobacter sp. M18
Brite
Enzymes [BR:geb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     GM18_1370
Secretion system [BR:geb02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   GM18_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1668132..1668923
Genome map
AA seq 263 aa AA seqDB search
MSFWKNLTTLFAATAAVATVAFAVPSFAMSEGCSGDCASCHSITLQEANSLLKEIGPVKD
VKASPVRGLYEITFEQQGKAGVAYIDYGKKHIIAGQIFDIASRQPVGGSVQVKQERKERL
DPATLTTEHALVLGNPNGKKKLFVFTDPECPYCSKAHVELKKLAALEPDLAIYIKLFPLK
MHPKAYDKSRVILARGSVELLDKSFAGQPLPAATEKDPKKPVDDTIRFAEANGINSTPTL
VLPDGRIVVGYKDAAGMRELLTK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctggaaaaatctcaccactctcttcgcagccactgccgccgtcgccaccgtt
gcctttgccgttccctccttcgccatgtctgaagggtgcagcggggattgcgcttcctgc
cactccatcacccttcaggaagccaattcacttctcaaggagatcggtccggtcaaggat
gtaaaggcgtcgcccgtacggggactgtacgaaatcacctttgagcagcagggcaaagcc
ggtgtcgcctatatcgattacggcaagaagcacattatcgccggccagatcttcgacatc
gcatcgaggcagccggtgggtggctcggtgcaggtgaagcaggaacgcaaggagcgcctc
gaccccgccacgcttaccaccgagcacgcgcttgttctcggaaaccccaacggaaagaag
aagctgttcgtcttcaccgaccccgagtgcccctactgctccaaggcgcacgtcgagctg
aagaagctggctgccctggagcctgacctcgccatctacatcaagctcttcccgctcaag
atgcacccgaaggcctacgacaagtcccgggtgatcctggcgcggggatcggtggagctg
cttgataaatctttcgccggacagccgctgccggcagcaacggagaaggaccccaaaaaa
ccggtggatgacaccatccgctttgcagaggccaacggcatcaactccacacccacgctg
gtgctgcctgacggccgcatcgtggtcgggtacaaggacgccgccgggatgcgggaattg
ctgacgaagtag

DBGET integrated database retrieval system