KEGG   Geobacter sp. M18: GM18_1705Help
Entry
GM18_1705         CDS       T01421                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
geb  Geobacter sp. M18
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GM18_1705
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GM18_1705
Enzymes [BR:geb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     GM18_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2062493..2063383
Genome map
AA seq 296 aa AA seqDB search
MENGIRMIGVPVDLGQEQRGVDLGPGALRYAGLSARLSQLGYLVEDIGNLPVPVRDVLGA
ERELRYLPSIRQVCETVYQAGRSAVAQGAMPIFMGGDHSMAIGSIGGVTDEQPTAVIWVD
AHGDYNTPDSTITGNIHGMALAALLGEGFPELVNVGRPGAKLHAADIVLIGLRELDPQEK
LRLRGSGIKAYTMRDIDERGMAAIAREALGRLAHRTRLHVSLDLDGLDPLEVPGVGTTAP
GGITYREAQLLMEIIADSGLLRSMDIVEINPILDHSNRTAKIAVELTASAFGASIL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacggcatcaggatgataggagtcccggtcgatctcgggcaggagcagcgcggc
gtcgacctcggcccgggcgccctgcgctacgcggggctgtcggcgcggctctcccagctt
ggctacctggtcgaggatatcggcaacctgccggttccggtgcgtgacgtgctgggcgcc
gagcgggaactccgctacctcccctcgatccggcaggtgtgcgagacggtctaccaggcg
gggcggagcgccgtagcccagggggccatgcccatcttcatgggtggggaccattccatg
gcgatcggctccatcggcggggtgaccgacgagcagccgaccgcggtgatctgggtcgat
gcccacggggactacaacaccccggacagcaccatcaccggcaacatccacggcatggcg
ctggcggccctgttgggggaggggttccccgaactggtcaacgtcgggcgtcccggggcc
aagctgcacgcagctgacatcgtgctgatcggcctgcgggagctcgatccccaggagaag
ctccgtctgcgcggcagcggcatcaaggcctacaccatgcgggacatcgacgagcgcggc
atggcggccatcgcccgcgaggcgctggggcggcttgcccatcgcacacggctgcacgtg
agcctcgacctggacgggttggacccgctcgaggtgccgggggtggggaccacagctccg
ggcggtatcacctatcgcgaggcgcagctgttgatggagatcattgccgacagcgggctg
ttgcggtcgatggacatcgtcgagatcaaccccatcctggaccacagcaaccggaccgcg
aagatagcggtcgagttgactgcctcggccttcggggcgtcgatcctataa

DBGET integrated database retrieval system