KEGG   Geobacter sp. M18: GM18_1720Help
Entry
GM18_1720         CDS       T01421                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
geb  Geobacter sp. M18
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    GM18_1720
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GM18_1720
Enzymes [BR:geb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     GM18_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2075299..2076231
Genome map
AA seq 310 aa AA seqDB search
MGFRHKDIIALKDLTKQEIELLLDTADSLSEINQRDIKKVPTLRGKTVINLFYEASTRTR
TSFEIAAKRLSADAVNITASTSSVVKGETLSDTAANLLAMQPDIIVMRHSVSGAHEYLAK
RVSCSVINAGDGAHEHPSQGLLDMLTMRQKFGKLAGLKVAIVGDITHSRVARSNIYGLTT
MGSQVFLAGPPTMMPPGIERLGNVTVCKDMREAVDQADVVMMLRIQLERQGKTLVPSMRE
YSRYFGLNPDVLTLAKKDAIVMHPGPINRGVELASSVADCDQSLILKQVENGVAVRMSML
YHVCGGEPAE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcaggcacaaagacatcatcgccctgaaggatctgaccaagcaggagatcgaa
ctgctcctcgacacggcggacagcctcagcgagatcaaccagcgggacatcaagaaggtg
ccgactctgcgcggcaagacggtgatcaaccttttctacgaggcctccaccaggacccgt
acctccttcgagatcgccgcgaaacgcttatccgcagatgccgtcaacatcaccgcgtcg
accagttccgtggtcaagggcgagaccctctccgacaccgccgccaacctcctcgccatg
cagcccgacatcatcgtgatgcggcattcggtctccggcgcgcacgagtacctcgcgaaa
agggtctcctgctccgtgatcaacgccggtgacggcgcccacgagcacccctcccagggg
cttctggacatgctcaccatgcgccagaagttcgggaaactggccggcctcaaggtcgcc
atcgtcggcgacatcacccacagccgcgtggcccgctccaacatctacggcctcaccacc
atgggctcccaggtcttcctggccggtcccccgaccatgatgcctcccggcatcgagcgt
ctgggcaacgtcaccgtctgcaaggacatgcgcgaagcggtggaccaggccgacgtggtg
atgatgctcaggatccagctggagcgccagggcaagacccttgtccccagcatgcgcgaa
tactcccgctacttcggcctcaaccccgacgtgctgaccctggccaagaaggacgccatc
gtcatgcaccccggcccgatcaaccgcggcgtggagctcgcctcctcggtagccgactgc
gaccagtccctgatcctgaagcaggtcgagaacggcgtcgcggtcaggatgtcgatgctg
tatcacgtctgcggcggcgagccggcggaataa

DBGET integrated database retrieval system