KEGG   Geobacter sp. M18: GM18_1766Help
Entry
GM18_1766         CDS       T01421                                 

Definition
phosphoribosylglycinamide formyltransferase
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
geb  Geobacter sp. M18
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GM18_1766
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    GM18_1766
Enzymes [BR:geb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     GM18_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2134388..2135002)
Genome map
AA seq 204 aa AA seqDB search
MEKELNIGVLISGSGSNLQSIIDACAAGAINGRVACVISNKADAFGLERATKAGIPALHL
DHRAYSGREAYDEALVATLREFGVELVVLAGFMRIITTVLLDAFPMRVMNIHPALLPSFP
GLHAQRQALEYGSKVAGCTVHFVDCGTDTGPIIIQAAVPVLEGDTEQSLSARIQREEHRI
YPEAIRLFSRGLLRVNGRVVTIAP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagagctcaacataggggtactgatctccggcagcggcagcaacctgcagtcc
atcatcgacgcctgcgccgccggtgcgatcaacgggcgcgtagcctgcgtgatcagcaac
aaggccgatgccttcggcctggagcgcgcaacaaaggcgggcatcccggcgctgcacctg
gaccaccgcgcctactccggccgtgaggcctacgacgaggcgctggtggcgaccctgcgc
gagttcggcgtggaactggtggtcctggcaggtttcatgcgcatcatcacgaccgtgctg
ctggacgccttcccgatgcgggtgatgaacatccacccggccctgctcccctcctttccc
gggctgcacgcccagcgccaggcgctcgagtacggctccaaggtcgccggctgcaccgtg
cacttcgtcgactgcggcaccgacaccggtcccatcatcatccaggcggcggttcctgtg
ctggagggtgacaccgagcagagtctctcggcgcgcatccagagggaagaacacaggatc
tatcccgaggcgatcaggctcttttcaaggggccttctccgggtaaacggacgggtggtc
accatcgccccctga

DBGET integrated database retrieval system