KEGG   Geobacter sp. M18: GM18_1766Help
Entry
GM18_1766         CDS       T01421                                 

Definition
(GenBank) phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
geb  Geobacter sp. M18
Pathway
geb00230  Purine metabolism
geb00670  One carbon pool by folate
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GM18_1766
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    GM18_1766
Enzymes [BR:geb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     GM18_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N
Motif
Other DBs
NCBI-ProteinID: ADW13230
JGI: GM18_1766
UniProt: E8WUK8
Position
complement(2134388..2135002)
Genome map
AA seq 204 aa AA seqDB search
MEKELNIGVLISGSGSNLQSIIDACAAGAINGRVACVISNKADAFGLERATKAGIPALHL
DHRAYSGREAYDEALVATLREFGVELVVLAGFMRIITTVLLDAFPMRVMNIHPALLPSFP
GLHAQRQALEYGSKVAGCTVHFVDCGTDTGPIIIQAAVPVLEGDTEQSLSARIQREEHRI
YPEAIRLFSRGLLRVNGRVVTIAP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagagctcaacataggggtactgatctccggcagcggcagcaacctgcagtcc
atcatcgacgcctgcgccgccggtgcgatcaacgggcgcgtagcctgcgtgatcagcaac
aaggccgatgccttcggcctggagcgcgcaacaaaggcgggcatcccggcgctgcacctg
gaccaccgcgcctactccggccgtgaggcctacgacgaggcgctggtggcgaccctgcgc
gagttcggcgtggaactggtggtcctggcaggtttcatgcgcatcatcacgaccgtgctg
ctggacgccttcccgatgcgggtgatgaacatccacccggccctgctcccctcctttccc
gggctgcacgcccagcgccaggcgctcgagtacggctccaaggtcgccggctgcaccgtg
cacttcgtcgactgcggcaccgacaccggtcccatcatcatccaggcggcggttcctgtg
ctggagggtgacaccgagcagagtctctcggcgcgcatccagagggaagaacacaggatc
tatcccgaggcgatcaggctcttttcaaggggccttctccgggtaaacggacgggtggtc
accatcgccccctga

DBGET integrated database retrieval system