KEGG   Geobacter sp. M18: GM18_1766Help
Entry
GM18_1766         CDS       T01421                                 

Definition
phosphoribosylglycinamide formyltransferase
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
geb  Geobacter sp. M18
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:geb00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:geb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2134388..2135002)
Genome map
AA seq 204 aa AA seqDB search
MEKELNIGVLISGSGSNLQSIIDACAAGAINGRVACVISNKADAFGLERATKAGIPALHL
DHRAYSGREAYDEALVATLREFGVELVVLAGFMRIITTVLLDAFPMRVMNIHPALLPSFP
GLHAQRQALEYGSKVAGCTVHFVDCGTDTGPIIIQAAVPVLEGDTEQSLSARIQREEHRI
YPEAIRLFSRGLLRVNGRVVTIAP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagagctcaacataggggtactgatctccggcagcggcagcaacctgcagtcc
atcatcgacgcctgcgccgccggtgcgatcaacgggcgcgtagcctgcgtgatcagcaac
aaggccgatgccttcggcctggagcgcgcaacaaaggcgggcatcccggcgctgcacctg
gaccaccgcgcctactccggccgtgaggcctacgacgaggcgctggtggcgaccctgcgc
gagttcggcgtggaactggtggtcctggcaggtttcatgcgcatcatcacgaccgtgctg
ctggacgccttcccgatgcgggtgatgaacatccacccggccctgctcccctcctttccc
gggctgcacgcccagcgccaggcgctcgagtacggctccaaggtcgccggctgcaccgtg
cacttcgtcgactgcggcaccgacaccggtcccatcatcatccaggcggcggttcctgtg
ctggagggtgacaccgagcagagtctctcggcgcgcatccagagggaagaacacaggatc
tatcccgaggcgatcaggctcttttcaaggggccttctccgggtaaacggacgggtggtc
accatcgccccctga

DBGET integrated database retrieval system