KEGG   Geobacter sp. M18: GM18_1891Help
Entry
GM18_1891         CDS       T01421                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
geb  Geobacter sp. M18
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GM18_1891
   01230 Biosynthesis of amino acids
    GM18_1891
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM18_1891
   00051 Fructose and mannose metabolism
    GM18_1891
   00562 Inositol phosphate metabolism
    GM18_1891
Enzymes [BR:geb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GM18_1891
Exosome [BR:geb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GM18_1891
  Exosomal proteins of bladder cancer cells
   GM18_1891
  Exosomal proteins of melanoma cells
   GM18_1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2279955..2280710)
Genome map
AA seq 251 aa AA seqDB search
MRKPVIAGNWKLYKTKDEALALIEELAPLVAGVSNVEIVVAPVFTVLPTLPAALAGTSIS
LAAQDVFWEEEGAFTGEVSPRMLLDAGASHVIIGHSERRQYFGETDETVNKKIKAALKGA
LVPIFCIGETLEAREAGETFKVLERQVKGGLEGLTETQFAPVIIAYEPVWAIGTGKVATD
EQAQEAHAFIRGVVAKLFSQSAADKVRILYGGSVKPENAKGLMACADIDGALVGGASLKG
ASFASIVRFGE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccggtcatagcaggtaactggaaactgtacaagacgaaggacgaggcgctg
gcactgatcgaggaactggccccgctggtcgcaggggtcagcaacgtggagatcgtggtg
gcaccggtgttcaccgtgctccccaccctccccgcagcactcgccggcaccagcatcagc
ctcgccgcccaggacgtcttctgggaggaggaaggtgccttcacgggtgaggtatccccg
cgcatgctgctcgacgccggcgcaagccacgtcatcatcgggcactccgagcgcaggcag
tacttcggcgaaacggacgagacggtgaacaagaagatcaaggcggccctcaagggggca
ctggtccctatcttctgcatcggcgagaccctggaggcacgcgaggcgggagagacgttc
aaggtgctggagcgccaggtgaagggaggcctggaggggctgaccgagacccagtttgca
ccggtcatcattgcctatgagccggtctgggccatcggcaccgggaaggtagccaccgac
gagcaggcccaggaggcccacgccttcatccgcggcgtcgtggccaaactgttcagccag
agcgccgcagacaaggtcaggatactgtacggcgggtcggtgaaacccgagaatgcgaaa
gggctgatggcctgcgctgacatagacggagccctggtggggggagcgagtctcaagggc
gcctcttttgcctcaatcgtccgtttcggcgaataa

DBGET integrated database retrieval system