KEGG   Geobacter sp. M18: GM18_2086Help
Entry
GM18_2086         CDS       T01421                                 

Definition
(GenBank) Propanoyl-CoA C-acyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
geb  Geobacter sp. M18
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GM18_2086
   00630 Glyoxylate and dicarboxylate metabolism
    GM18_2086
   00640 Propanoate metabolism
    GM18_2086
   00650 Butanoate metabolism
    GM18_2086
  Lipid metabolism
   00071 Fatty acid degradation
    GM18_2086
   00072 Synthesis and degradation of ketone bodies
    GM18_2086
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GM18_2086
   00310 Lysine degradation
    GM18_2086
   00380 Tryptophan metabolism
    GM18_2086
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GM18_2086
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GM18_2086
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GM18_2086
Enzymes [BR:geb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GM18_2086
Exosome [BR:geb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GM18_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2498966..2500258
Genome map
AA seq 430 aa AA seqDB search
MRPVYMISGGITKFAKALPQTDFRRMVKDAFDYALADLPGLSRDQIDGSVCSCFSDHFTR
QLMAGAMVQDYLGLNPKPSRRVEGGGATGGLCFQSAWESVASGRMEVCLAMGFETMGRVN
TWKGNEFIALASDTNFDYPVGGFYTGYYAMMVNRHMHEFGTTVEQMAKVAIKNHLNAVYN
PYAQRPGRLTIEDVRTALMVAEPLTILDCCQMSDGAAVAILASEEMAQKLGGTPVRVTGV
GSGTDAMRMADRPQGEVMLLPHETREEYADLKYPGVHSFRGGRMAAKNAYRMAGINDPGQ
ELDFVELHDAYTSSEIQTCEDLGLCRYGEGGSFVDSGAPFMPNLHYGLTFSGSEKWRPLP
VNPSGGLLACGHPVGATGLMQAVFAFWQLQGTIEKHLKDATLQLPDPRRGLIHSHAGTGT
YITVSIMERV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgtctacatgatatcggggggaatcaccaagttcgccaaggcgctcccccag
accgatttccgccgcatggtgaaggacgccttcgattacgccctggccgatcttccgggc
ttgagccgcgaccagatcgacggcagcgtctgttcctgcttctcggaccatttcaccaga
cagctcatggcgggggcgatggtgcaagactacctggggctgaaccccaagccgtcgcgc
cgggtcgagggaggaggagcgacggggggactctgtttccagtcggcctgggagtcggtc
gcctccggccgcatggaggtctgcctcgccatggggttcgagaccatgggccgggtcaac
acctggaaggggaacgagttcatagcactcgcctccgacaccaacttcgactatcccgtg
ggaggtttctacacaggctattacgccatgatggtgaaccgccacatgcacgagttcggg
accacggtggagcagatggcgaaggtcgccatcaagaaccatctgaatgcggtctacaat
ccctacgcgcagcggccggggaggctcaccatagaagacgtccgcacggcactgatggtt
gccgagcctctgaccatcctggactgctgccagatgtccgacggggccgccgttgcgatc
cttgcttctgaggaaatggcccagaaattgggcgggacgccggtgcgggtgaccggagtc
gggagcggcacagatgccatgcgcatggccgaccgcccccagggcgaggtgatgcttttg
ccccacgaaacacgcgaagagtacgcggatctgaagtatccgggcgtgcactcgttccgc
ggggggcgcatggctgccaagaacgcctaccgcatggccggaatcaacgatcccgggcag
gagctcgacttcgtggagctgcacgacgcctacacctcctccgagatccagacctgcgag
gatcttggcctgtgccgctatggagaggggggcagtttcgtggattccggggctcccttc
atgcccaacctccattacggcctgaccttttcggggtccgagaagtggcgtccgctcccg
gtgaacccctccggagggcttctcgcctgcggtcatcccgtgggcgccaccgggctcatg
caggccgtttttgccttctggcaattgcaggggaccatcgagaagcatctgaaggatgcc
accctgcagcttcccgatccgcggcgcgggctgattcacagccatgccgggaccggaacc
tacatcaccgtatcgatcatggagagggtgtga

DBGET integrated database retrieval system